VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


Gap

General Information
Protegen ID 823
Sequence Strain (Species/Organism) Brucella abortus bv. 1 str. 9-941
VO ID VO_0012375
Taxonomy ID 262698
Molecule Role Protective antigen
Molecule Role Annotation GAPDH (Gap) associated with murine IL-12 gene in a DNA vaccine formulation partially protected mice against experimental infection (Rosinha et al., 2002b).
References
Rosinha et al., 2002b: Rosinha GM, Myioshi A, Azevedo V, Splitter GA, Oliveira SC. Molecular and immunological characterisation of recombinant Brucella abortus glyceraldehyde-3-phosphate-dehydrogenase, a T- and B-cell reactive protein that induces partial protection when co-administered with an interleukin-12-expressing plasmid in a DNA vaccine formulation. Journal of medical microbiology. 2002; 51(8); 661-671. [PubMed: 12171297].
Gene Information
Gene Name Gap
NCBI Gene ID 3340207
Genbank Accession AE017223
Chromosome No I
Locus Tag BruAb1_1713
Gene Starting Position 1684720
Gene Ending Position 1685727
DNA Sequence
>NC_006932.1:1684720-1685727 Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence
AATGGCAGTTCGCGTCGCAATCAACGGTTTTGGCCGCATTGGCCGTAACATCCTTCGCGCCATCGTGGAA
TCGGGGCGCACCGACATTCAGGTCGTCGCCATCAACGATCTCGGCCCGGTCGAAACCAACGCACATCTTC
TGCGTTATGACAGCGTTCATGGCCGTTTCCCCAAGGAAGTGGAGGTTGCAGGCGATACGATCGATGTTGG
CTACGGCCCGATCAAGGTTCATGCCGTCCGCAACCCGGCCGAACTGCCGTGGAAGGAAGAAAACGTCGAT
ATCGCCCTTGAATGCACCGGCATTTTCACCTCGCGCGACAAGGCAGCACTTCATCTTGAAGCTGGCGCCA
AGCGCGTCATCGTCTCCGCTCCCGCAGACGGTGCCGATCTCACCGTCGTCTATGGTGTCAACAACGACAA
GCTGACGAAGGACCATCTGGTCATCTCCAACGCTTCGTGTACCACCAACTGCCTTGCGCCGGTGGCTCAG
GTTCTCAACGATACTATCGGTATCGAAAAGGGCTTCATGACCACGATCCACTCCTATACGGGCGACCAGC
CGACGCTGGACACCATGCACAAGGATCTCTACCGCGCCCGCGCCGCTGCCCTTTCCATGATCCCGACCTC
GACGGGTGCGGCCAAGGCCGTCGGTCTCGTTCTGCCGGAACTGAAAGGCAAGCTCGACGGCGTTGCCATT
CGCGTCCCGACCCCAAATGTCTCGGTCGTTGATCTCACCTTCATCGCCAAGCGTGAAACCACCGTTGAAG
AAGTCAACAATGCGATCCGCGAAGCCGCCAATGGCCGCCTCAAGGGCATTCTCGGCTATACCGATGAGAA
GCTCGTCTCGCACGACTTCAACCACGATTCCCATTCCTCGGTCTTCCACACCGACCAGACCAAGGTTATG
GACGGCACCATGGTGCGTATCCTGTCGTGGTACGACAATGAATGGGGCTTCTCCAGCCGCATGAGCGACA
CCGCCGTCGCTTTGGGCAAGCTGATCTG

Protein Information
Protein Name glyceraldehyde-3-phosphate dehydrogenase
NCBI Protein GI 62290600
Protein Accession YP_222393
Protein pI 6.44
Protein Weight 32765.28
Protein Length 335
Protein Note catalyzes the formation of 3-phospho-D-glyceroyl phosphate from D-glyceraldehyde 3-phosphate
Protein Sequence
>YP_222393.1 glyceraldehyde-3-phosphate dehydrogenase [Brucella abortus bv. 1 str. 9-941]
MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEVAGDTIDVG
YGPIKVHAVRNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADGADLTVVYGVNNDK
LTKDHLVISNASCTTNCLAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPTS
TGAAKAVGLVLPELKGKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLKGILGYTDEK
LVSHDFNHDSHSSVFHTDQTKVMDGTMVRILSWYDNEWGFSSRMSDTAVALGKLI

Vaxign Prediction
Localization(Probability) Cytoplasmic
(Prob.=0.997)
Adhesin Probability 0.361
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope