VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


SurA

General Information
Protegen ID 258
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010971
Taxonomy ID 359391
Molecule Role Protective antigen
Molecule Role Annotation Brucella SurA is a protective antigen (Delpino et al., 2007b).
COG COG0760O, under O: Posttranslational modification, protein turnover, chaperones
Related Vaccines(s) Brucella recombinant SurA protein vaccine
References
Delpino et al., 2007b: Delpino MV, Estein SM, Fossati CA, Baldi PC, Cassataro J. Vaccination with Brucella recombinant DnaK and SurA proteins induces protection against Brucella abortus infection in BALB/c mice. Vaccine. 2007; 25(37-38); 6721-6729. [PubMed: 17686554].
Gene Information
Gene Name SurA
NCBI Gene ID 3787419
Genbank Accession JMRZ01000012
Chromosome No I
Locus Tag BAB_RS19295
Gene Starting Position 688353
Gene Ending Position 689309
DNA Sequence
>NC_007618.1:688353-689309 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
GTCAACGATTGACGATGGTGGCCTTTTCGCGCAGTTCCTGCACGTATTTCTTGCTGAGTTCCTCAGCCTT
CTTTTCCTGCCCCGCAGGGGAATCCGCGCCTTCCATGGAGAAGACAAGCTGTGCAACGCGGTCATCCGAC
ACCTGACGGGTGGAGCATACGGCCAGGAATTCAACACCCTTTTCCGTATCGTGCGGCTTGGTCGTCCGGT
TGACGCCAGCGGCCTTCACATCCTTGGACCATTCGCCGGGCAATTGCGGCTCGATGATACGGCCAAGATC
GCGGACGGTCACATCGAGAATGCCCTTGGCTTGCTGGCGCGTGCTGTCACAATTCTGGAAGCGCGCGCGC
AACGCATTGGCTTCCTGACGGCGTTTTGCCAGAAGAGCGGGCGAACGCTTGGAGGCGGGGACCACGAAAA
TCACCTGCTGGAGATGATATTCAGTTGCAACGGGCTTCTTTCCGCCGTTCTTCAGCATACGCTGCACGGC
TTCCTGCTCACTGACCATGCCGGTCGCGCGGAAGCGGGCGCTGACAAGGCGGCCCCAGCCCATCTGGACC
ATGATATATTTCTTGAAATGTTCCGGCGTGACGCCCGACTGGTTCATAACCTGATTGAGCTGCGCCAGCG
TCATCTTGTTGCGGCTTGCAAACCCGGCATAGGCGTCATCCACTTCCTTATCGGAAATATTGATGCCACG
CGATTTCATCTCGATGCGCTTGAGCATTTCTTCGGTAAGCTCGTTGCGCGCAAGCTGGTTGAGATTGCCG
CTTTTACGCTGAAGCTTGAGGAAGGCCATACGGTGCTTGATGTCGCTATTGGTAATAGCATTGCCGGACA
CGATGACTTTGACCTCGGATTCTCCTGCGGCGAAAGCTGGAGCCGCAACCGTTCCAAGCGCCGTCAAGCA
AACGGCAGCGCCTAGCATGGAGGCGATAAGAGGTCTTGCAAACATCA

Protein Information
Protein Name molecular chaperone SurA
NCBI Protein GI 489056605
Protein Accession WP_002966738
Protein pI 10.47
Protein Weight 32511.89
Protein Length 318
Protein Sequence
>WP_002966738.1 MULTISPECIES: peptidylprolyl isomerase [Brucella]
MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRKSGNLNQLA
RNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSGVTPEHFKKYIMVQMGWGR
LVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFVVPASKRSPALLAKRRQEANALRARFQNC
DSTRQQAKGILDVTVRDLGRIIEPQLPGEWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQ
LVFSMEGADSPAGQEKKAEELSKKYVQELREKATIVNR

Vaxign Prediction
Localization(Probability) Unknown
(Prob.=0.49)
Adhesin Probability 0.314
Trans-membrane Helices 1
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope