VP1 |
| General Information |
| Protegen ID |
1667 |
|
Sequence Strain (Species/Organism) |
Duck hepatitis A virus strain ZJ serotype 1 |
|
Taxonomy ID |
1006061
|
|
Molecule Role |
Protective antigen |
| Related Vaccines(s) |
Duck hepatitis virus 1 DNA vaccine pSCA/VP1
|
| References |
|
| Gene Information |
|
Gene Name |
VP1 |
| Protein Information |
|
Protein Name |
VP1 protein |
|
NCBI Protein GI |
129307224
|
|
Protein pI |
6.87 |
|
Protein Weight |
25110.8 |
|
Protein Length |
303 |
|
Protein Note |
vaccine strain; modified live virus |
|
Protein Sequence |
>ABO30521.1 VP1 protein, partial [Duck hepatitis A virus 1]
GDSNQLGDDEPVCFLNFETANVPIQGESHTLVKHLFGRQWLVRTVQHASTVQELDLQVPDRGHASLIRFF
AYFSGEIILTIVNNGTTPAMVAHSYSMDDLSSEYAVTAMGGVMIPANSAKNIPVPFYSVTPLRPTRPIPG
TSEATFGRLFMWTQSGSLSVFMGLKKPALFFPLPAPTSTTLSRGSNGVIPTLDQSGDEVDCHFCKICSKM
KRMWKPKGHFRFCLRLKTLAFELDLEIE
|
| Epitope Information |
| IEDB Linear Epitope |
|
| IEDB ID |
Epitope |
MHC restriction |
Starting position |
Ending position |
| IEDB ID |
Epitope |
Starting position |
Ending position |
| 451318 |
GEIILT |
75 |
81 |
| 241329 |
LPAPTS |
173 |
179 |
| 881793 |
PAPTST |
174 |
180 |
|
|
|
GDSNQLGDDEPVCFLNFETANVPIQGESHTLVKHLFGRQWLVRTVQHASTVQELDLQVPDRGHASLIRFFAYFSGEIILTIVNNGTTPAMVAHSYSMDDLSSEYAVTAMGGVMIPANSAKNIPVPFYSVTPLRPTRPIPGTSEATFGRLFMWTQSGSLSVFMGLKKPALFFPLPAPTSTTLSRGSNGVIPTLDQSGDEVDCHFCKICSKMKRMWKPKGHFRFCLRLKTLAFELDLEIE
|