VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


omp31

General Information
Protegen ID 1609
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
Taxonomy ID 224914
Other Database IDs CDD:226163
Molecule Role Protective antigen
Related Vaccines(s) B. melitensis DNA vaccine pCI-Omp31 , B. melitensis DNA vaccine pCIBLSOmp31 encoding BLSOmp31 (fusion protein)
References  
Gene Information
Gene Name omp31
Protein Information
Protein Name 31 kDa outer-membrane immunogenic protein
NCBI Protein GI 61229373
Protein pI 5.06
Protein Weight 24732.46
Protein Length 343
Protein Note biovar: 1 str. 16M
Protein Sequence
>sp|P0A3U4.1|OM31_BRUME RecName: Full=31 kDa outer-membrane immunogenic protein; Flags: Precursor
MKSVILASIAAMFATSAMAADVVVSEPSAPTAAPVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQ
VSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARL
GYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEYAINNNWTLKSEYLYTDL
GKRNLVDVDNSFLESKVNFHTVRVGLNYKF

Vaxign Prediction
Localization(Probability) Outer Membrane
(Prob.=1)
Adhesin Probability 0.836
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope