VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


NP

General Information
Protegen ID 1230
Sequence Strain (Species/Organism) Lymphocytic choriomeningitis virus Armstrong
Taxonomy ID 11623
Other Database IDs CDD:279216
Molecule Role Protective antigen
Related Vaccines(s) Lymphocytic choriomeningitis virus DNA vaccine pCMV-NP
References  
Gene Information
Gene Name NP
Protein Information
Protein Name nucleoprotein
NCBI Protein GI 61655717
Protein pI 8.92
Protein Weight 58776.522
Protein Length 639
Protein Note Arenavirus nucleocapsid protein; pfam00843
Protein Sequence
>AAX49342.1 nucleoprotein [Lymphocytic choriomeningitis mammarenavirus]
MSLSKEVKSFQWTQALRRELQSFTSDVKAAVIKDATNLLNGLDFSEVSNVQRIMRKEKRDDKDLQRLRSL
NQTVHSLVDLKSTSKKNVLKVGRLSAEELMSLAADLEKLKAKIMRSERPQASGVYMGNLTTQQLDQRSQI
LQIVGMRKPQQGASGVVRVWDVKDSSLLNNQFGTMPSLTMACMAKQSQTPLNDVVQALTDLGLLYTVKYP
NLNDLERLKDKHPVLGVITEQQSSINISGYNFSLGAAVKAGAALLDGGNMLESILIKPSNSEDLLKAVLG
AKRKLNMFVSDQVGDRNPYENILYKVCLSGEGWPYIACRTSIVGRAWENTTIDLTSEKPAVNSPRPAPGA
AGPPQVGLSYSQTMLLKDLMGGIDPNAPTWIDIEGRFNDPVEIAIFQPQNGQFIHFYREPVDQKQFKQDS
KYSHGMDLADLFNAQPGLTSSVIGALPQGMVLSCQGSDDIRKLLDSQNRKDIKLIDVEMTREASREYEDK
VWDKYGWLCKMHTGIVRDKKKKEITPHCALMDCIIFESASKARLPDLKTVHNILPHDLIFRGPNVVTL

Epitope Information
IEDB Linear Epitope