VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Poliovirus

Table of Contents
  1. Protective Antigens
    1. VP4
1. VP4
  • Gene Name : VP4
  • Sequence Strain (Species/Organism) : Human poliovirus 1
  • VO ID : VO_0011244
  • NCBI Protein GI : 68532656
  • Other Database IDs : CDD:280403
  • Taxonomy ID : 12080
  • Gene Strand (Orientation) : ?
  • Protein Name : VP4
  • Protein pI : 7.69
  • Protein Weight : 7576.69
  • Protein Length : 117
  • Protein Note : Picornavirus coat protein (VP4); pfam02226
  • Protein Sequence : Show Sequence
    >BAE06026.1 VP4, partial [Human poliovirus 1]
    MGAQVSSQKVGAHENSNRASGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : To examine the mechanism of immunity in vivo, researchers used poliovirus receptor-transgenic mice on a BALB/c (H-2d) background. Mice immunized with the vaccine strain were protected against a subsequent challenge with wild-type virus. Protection was observed when mice received primed B cells in the presence of a VP4-specific Th1 clone. Findings demonstrate that CD4+ T cells, specific for the internal poliovirus capsid protein, VP4, can provide effective help for a protective antibody response directed against surface capsid proteins (Mahon et al., 1995).
II. References
1. Mahon et al., 1995: Mahon BP, Katrak K, Nomoto A, Macadam AJ, Minor PD, Mills KH. Poliovirus-specific CD4+ Th1 clones with both cytotoxic and helper activity mediate protective humoral immunity against a lethal poliovirus infection in transgenic mice expressing the human poliovirus receptor. The Journal of experimental medicine. 1995; 181(4); 1285-1292. [PubMed: 7699320].