VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Fowlpox virus

Table of Contents
  1. Protective Antigens
    1. L1
1. L1
  • Gene Name : L1
  • Sequence Strain (Species/Organism) : Fowlpox virus
  • NCBI Protein GI : P15910
  • Other Database IDs : CDD:280581
  • Taxonomy ID : 928301
  • Protein Name : Protein L1 homolog
  • Protein pI : 8.25
  • Protein Weight : 26579.04
  • Protein Length : 346
  • Protein Note : Virion membrane protein M25
  • Protein Sequence : Show Sequence
    >sp|P15910.4|L1_FOWPN RecName: Full=Protein L1 homolog; AltName: Full=Virion membrane protein M25
    MGAAASIQTTVTTINKKISEKLEQTASASATANCDINIGNIIFKKNKGCNVLVKNMCSANASAQLDAIVS
    AVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAVINNIINVQSLEVDECSAPP
    GQIMTFEFINTGTATGNCAMKSVLDVLTKSSDRVSGNQSTGNDFSKYLYIIGGIICFLILLYYAKKLFFM
    STNDKVKVLLAKKPDVHWTTYIDTYFRSSPVLV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Pacchioni et al., 2013)
II. References
1. Pacchioni et al., 2013: Pacchioni SM, Bissa M, Zanotto C, Morghen Cde G, Illiano E, Radaelli A. L1R, A27L, A33R and B5R vaccinia virus genes expressed by fowlpox recombinants as putative novel orthopoxvirus vaccines. Journal of translational medicine. 2013; 11; 95. [PubMed: 23578094].