VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Chicken Anemia Virus

Table of Contents
  1. Protective Antigens
    1. VP1
    2. VP2
1. VP1
  • Gene Name : VP1
  • Sequence Strain (Species/Organism) : Chicken Anemia Virus
  • NCBI Protein GI : ABJ90436
  • Other Database IDs : CDD:282072
  • Taxonomy ID : 12618
  • Protein Name : VP1
  • Protein pI : 11.12
  • Protein Weight : 50262.7
  • Protein Length : 496
  • Protein Note : Gyrovirus capsid protein (VP1); pfam04162
  • Protein Sequence : Show Sequence
    >ABJ90436.1 VP1 [Chicken anemia virus]
    MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTI
    RFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKS
    QAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRF
    QLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPP
    DPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKG
    QRWHTLVPLGTETITDSYMGAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQ
    SVWQLGNRQRPYPWDVNWANSTMYWGGQP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Sawant et al., 2015)
2. VP2
  • Gene Name : VP2
  • Sequence Strain (Species/Organism) : Chicken Anemia Virus
  • NCBI Protein GI : AIU44252
  • Other Database IDs : CDD:251643
  • Taxonomy ID : 12618
  • Protein Name : VP2
  • Protein pI : 7.89
  • Protein Weight : 23530.11
  • Protein Length : 260
  • Protein Note : TT viral ORF2; pfam02957
  • Protein Sequence : Show Sequence
    >AIU44252.1 VP2 [Chicken anemia virus]
    MHGNGGQPAAGGSESALSREGQPGPSGAAQGQVISNERSPRRYSTRTINGVQATNKFTAVGNPSLQRDPD
    WYRWNYNHSIAVWLRECSRSHAKICNCGQFRKHWFQECAGLEDRSTQASLEEAILRPLRVQGKRAKRKLD
    YHYSQPTPNRKKVYKTVRWQDELADREADFTPSEEDGGTTSSDFDEDINFDIGGDSGIVDELLGRPFTTP
    APVRIV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Sawant et al., 2015)
II. References
1. Sawant et al., 2015: Sawant PM, Dhama K, Rawool DB, Wani MY, Tiwari R, Singh SD, Singh RK. Development of a DNA vaccine for chicken infectious anemia and its immunogenicity studies using high mobility group box 1 protein as a novel immunoadjuvant indicated induction of promising protective immune responses. Vaccine. 2015; 33(2); 333-340. [PubMed: 25448094].