|
|
Ricin toxin of Ricinus communis |
| Table of Contents |
- Protective Antigens
- Ricin A chain
|
| I. Vaccine Related Protective Antigens |
|
1. Ricin A chain
|
-
Gene Name :
Ricin A chain
-
NCBI Protein GI :
269979609
-
3D structure: PDB ID :
3BJG
-
Other Database IDs :
CDD:278586
-
Taxonomy ID :
3988
-
Gene Strand (Orientation) :
?
-
Protein Name :
ricin A chain
-
Protein pI :
5.64
-
Protein Weight :
20645.58
-
Protein Length :
250
-
Protein Note :
Ribosome inactivating protein; pfam00161
-
Protein Sequence : Show Sequence
>ACZ56254.1 ricin A chain, partial [Ricinus communis]
GPGPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELS
VTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIEL
GNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRVP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Vaccination against ricin using either denatured toxin or its modified A chain subunit (RTA) has been successful in experimental animals but both vaccines have potential toxicities. Recombinant (r) RTA has not been evaluated as a vaccine. However, the advantage of such a vaccine is that these potential toxicities can be deleted by appropriate mutations. In this study three mutants were generated and shown that two lack toxicity as compared to the wild type rRTA. These mutants induce protective humoral immune responses in mice (Smallshaw et al., 2002).
|
| II. References |
1. Smallshaw et al., 2002: Smallshaw JE, Firan A, Fulmer JR, Ruback SL, Ghetie V, Vitetta ES. A novel recombinant vaccine which protects mice against ricin intoxication. Vaccine. 2002; 20(27-28); 3422-3427. [PubMed: 12213413].
|
|
