VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


eltB

General Information
Protegen ID 92
Sequence Strain (Species/Organism) Escherichia coli
VO ID VO_0010943
Taxonomy ID 562
Other Database IDs CDD:279687
Molecule Role Protective antigen
Molecule Role Annotation LT is a hetero-oligomeric AB5 type enterotoxin composed of a 27 kDa A subunit with toxic ADP ribosyl transferase activity and a stable noncovalent-linked pentamer of 11.6 kDa B subunits. ETEC infection and colonization of the small intestine, and the production of LT, causes acute diarrhea that can be fatal without intervention (Moravec et al., 2007).

Immunized mice developed antibodies that were capable of detecting each recombinant subunit in addition to native CS6 protein and also protected the mice against ETEC challenge. (Zeinalzadeh et al., 2017)
Related Vaccines(s) soybean-expressed E. coli LTB vaccine
References
Moravec et al., 2007: Moravec T, Schmidt MA, Herman EM, Woodford-Thomas T. Production of Escherichia coli heat labile toxin (LT) B subunit in soybean seed and analysis of its immunogenicity as an oral vaccine. Vaccine. 2007 Feb 19; 25(9); 1647-57. [PubMed: 17188785].
Zeinalzadeh et al., 2017: Zeinalzadeh N, Salmanian AH, Goujani G, Amani J, Ahangari G, Akhavian A, Jafari M. A Chimeric protein of CFA/I, CS6 subunits and LTB/STa toxoid protects immunized mice against enterotoxigenic Escherichia coli. Microbiology and immunology. 2017; 61(7); 272-279. [PubMed: 28543534].
Gene Information
Gene Name eltB
Protein Information
Protein Name LTB
NCBI Protein GI 157021162
3D structure: PDB ID 1PZI
Protein pI 8.8
Protein Weight 13952.05
Protein Length 162
Protein Note Heat-labile enterotoxin beta chain; pfam01376
Protein Sequence
>ABV01313.1 LTB [Escherichia coli]
MNKVKCYVLFTALLSSLYAHGAPQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQ
VEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN

Epitope Information
IEDB Linear Epitope