VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


ompU

General Information
Protegen ID 813
Sequence Strain (Species/Organism) Listonella anguillarum
VO ID VO_0011344
Taxonomy ID 55601
Other Database IDs CDD:225744
CDD:238208
Molecule Role Protective antigen
Molecule Role Annotation Asian seabass vaccinated with the OMP38 (OmpU) DNA vaccine was challenged with pathogenic V. anguillarum by intramuscular injection. A relative percent survival (RPS) rate of 55.6% was recorded (Kumar et al., 2007).
References
Kumar et al., 2007: Kumar SR, Parameswaran V, Ahmed VP, Musthaq SS, Hameed AS. Protective efficiency of DNA vaccination in Asian seabass (Lates calcarifer) against Vibrio anguillarum. Fish & shellfish immunology. 2007; 23(2); 316-326. [PubMed: 17337208].
Gene Information
Gene Name ompU
Protein Information
Protein Name major outer membrane protein OmpU
NCBI Protein GI 26513901
Protein pI 4.45
Protein Weight 33790.35
Protein Length 403
Protein Note Outer membrane protein (porin) [Cell wall/membrane/envelope biogenesis]; COG3203
Protein Sequence
>AAN78349.1 major outer membrane protein OmpU [Vibrio anguillarum]
MNKTLIALAVSAAAVVTGVNAGELYNQDGTSLEMGGRAEARLSLKDGKADDASRVRLNFLGKVAINDSLY
GVGFYEGEFTTADEGTADNKGDLDNRYTYAGIGGNFGEVTYGKNDGALGVITDFTDIMSYHGNKAAYKIV
VADRVDNMVAYKGQFADLGVKASYRFADRQESTSAITDNNADGYSLSAIYAIGDTGVKLGAGYADQDTAA
NASSDQYMLAASYAISDFYFAGTFVDGQDKAASKTDKTGYELAAKYTMGQAVFTSTYNYLESKNSGAKKD
KADSFAVDATYFFKPNFRSYISYNFNLLDSDKVGKAKSEDELALGLRYDF

Epitope Information
IEDB Linear Epitope