Priest et al., 2010: Priest JW, Kwon JP, Montgomery JM, Bern C, Moss DM, Freeman AR, Jones CC, Arrowood MJ, Won KY, Lammie PJ, Gilman RH, Mead JR. Cloning and characterization of the acidic ribosomal protein P2 of Cryptosporidium parvum, a new 17-kilodalton antigen. Clinical and vaccine immunology : CVI. 2010; 17(6); 954-965. [PubMed: 20410328].
Ribosomal protein P2. This subfamily represents the eukaryotic large ribosomal protein P2. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P2 is located in the L12 stalk, with proteins...; cd05833
Protein Sequence
>AAF21857.1 acidic ribosomal protein P2 [Cryptosporidium parvum]
MGMKYVAAYLLCVSSGKEQPTASDIKKVLESVGIEYDQSIIDVLISNMSGKLSHEVIASGLSKLQSVPTG
GVAVSGGAAAASGAAQDSAPAEKKKEEEEEEEGDLGFSLFD
