Ching et al., 2017: Ching XT, Fong MY, Lau YL. Evaluation of the Protective Effect of Deoxyribonucleic Acid Vaccines Encoding Granule Antigen 2 and 5 Against Acute Toxoplasmosis in BALB/c Mice. The American journal of tropical medicine and hygiene. 2017; 96(6); 1441-1447. [PubMed: 28719288].
encoded by transcript TGME49_286450; Signal peptide predicted by SignalP 2.0 HMM (probability 0.923) with cleavage site probability 0.441 at residue 26; Predicted trans-membrane domain (TMHMM2.0):6-26:70-93; GO_component: GO:0020003 - symbiont-containing vacuole;ev_code=EXP; GO_component: GO:0045177 - apical part of cell;ev_code=EXP
Protein Sequence
>EPT31025.1 dense granule protein GRA5 [Toxoplasma gondii ME49]
MASVKRVVVAVMIVNVLALIFVGVAGSTRDTGSGGDDSEGAWGGEQQQVQQHGQSEDRSLFERGRAAVTG
HPVRTAVGLAAAVVAVVSLLRLLRRRRRRAIQEESKESATAEEEEVAEEE
