Khan et al., 2017: Khan S, Oosterhuis K, Wunderlich K, Bunnik EM, Bhaggoe M, Boedhoe S, Karia S, Steenbergen RDM, Bosch L, Serroyen J, Janssen S, Schuitemaker H, Vellinga J, Scheper G, Zahn R, Custers J. Development of a replication-deficient adenoviral vector-based vaccine candidate for the interception of HPV16- and HPV18-induced infections and disease. International journal of cancer. 2017; 141(2); 393-404. [PubMed: 28263390].

>AAP20594.1 E6 protein [Human papillomavirus type 18]
MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCID
FYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHS
CCNRARQERLQRRRETQV