VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


ORFV011

General Information
Protegen ID 4251
Sequence Strain (Species/Organism) Orf Virus
Taxonomy ID 10258
Other Database IDs CDD:177506
CDD:197205
CDD:301585
CDD:197546
CDD:197206
Molecule Role Protective antigen
Molecule Role Annotation (Zhao et al., 2011)
References
Zhao et al., 2011: Zhao K, He W, Gao W, Lu H, Han T, Li J, Zhang X, Zhang B, Wang G, Su G, Zhao Z, Song D, Gao F. Orf virus DNA vaccines expressing ORFV 011 and ORFV 059 chimeric protein enhances immunogenicity. Virology journal. 2011; 8; 562. [PubMed: 22204310].
Gene Information
Gene Name ORFV011
Protein Information
Protein Name ORFV011
NCBI Protein GI AGY41811
Protein pI 6.42
Protein Weight 38341
Protein Length 417
Protein Note palmytilated EEV membrane glycoprotein; Provisional
Protein Sequence
>AGY41811.1 ORFV011 [Orf virus]
MWPFSSIPVGADCRVVETLPAEVASLAQGNMSTLDCFTAIAESAKKFLYICSFCCNLSSTKEGVDVKDKL
CTLAKEGVDVTLLVDVQSKDKDADELREAGVNYYKVKVSTREGVGNLLGSFWISDAGHWYVGSASLTGGS
VSTIKNLGLYSTNKHLAWDLMNRYNTFYSMIVEPKVPFTRLCCAVVTPTATNFHLNHSGGGVFFSDSPER
FLGFYRTLDEDLVLHRIENAKNSIDLSLLSMVPVIKHAGAVEYWPRIIDALLRAAIDRGVRVRVIITEWK
NADPLSVSAARSLDDFGVGSVDMSVRKFVVPGRDDAANNTKLLIVDDTFAHLTVANLDGTHYRYHAFVSV
NAEKGDIVKDLSAVFERDWRSEFCKPIN

Epitope Information
IEDB Linear Epitope