VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


SodC from B. abortus strain 2308

General Information
Protegen ID 3
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010856
Taxonomy ID 359391
Molecule Role Protective antigen
Molecule Role Annotation IMMUNOGENICITY: Induces antigen-specific Th1 immune response, as indicated by the specific induction of serum IgG2a, but not IgG1, antibodies and by the secretion of IFN-γ, but not IL-4, by the Cu/Zn SOD-stimulated splenocytes. Has been used for vaccine development (Vemulapalli et al., 2000; He et al., 2002; Onate et al., 2003).

MUTATION: An isogenic sodC mutant constructed from B abortus 2308 by gene replacement exhibited much greater susceptibility to killing by exogenous O(2)(-) than the parental 2308 strain, supporting a role for SodC in protecting this bacterium from O(2)(-) stress. The B abortus sodC mutant was much more sensitive to killing by cultured resident peritoneal macrophages from C57BL6J mice than 2308, and its attenuation in cultured murine macrophages was enhanced when these phagocytes were treated with gamma interferon. The attenuation of the B abortus sodC mutant in both resting and IFN-gamma-activated macrophages was alleviated in the presence of the NADPH oxidase inhibitor apocynin. Consistently, the B abortus sodC mutant also displayed significant attenuation in infected C57BL6J mice compared to the parental strain. These findings suggest that SodC protects B abortus 2308 from the respiratory burst of host macrophages (Gee et al., 2005).
COG COG2032P, under P: Inorganic ion transport and metabolism
Related Vaccines(s) B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12 , B. abortus DNA vaccine pcDNA-SOD , B. abortus DNA vaccine pcDNA3-SOD encoding Cu-Zn SOD , Recombinant B. abortus RB51SOD
References
Gee et al., 2005: Gee JM, Valderas MW, Kovach ME, Grippe VK, Robertson GT, Ng WL, Richardson JM, Winkler ME, Roop RM 2nd. The Brucella abortus Cu,Zn superoxide dismutase is required for optimal resistance to oxidative killing by murine macrophages and wild-type virulence in experimentally infected mice. Infection and immunity. 2005 May; 73(5); 2873-80. [PubMed: 15845493].
He et al., 2002: He Y, Vemulapalli R, Schurig GG. Recombinant Ochrobactrum anthropi expressing Brucella abortus Cu,Zn superoxide dismutase protects mice against B. abortus infection only after switching of immune responses to Th1 type. Infection and immunity. 2002 May; 70(5); 2535-43. [PubMed: 11953393].
Onate et al., 2003: Onate AA, Cespedes S, Cabrera A, Rivers R, Gonzalez A, Munoz C, Folch H, Andrews E. A DNA vaccine encoding Cu,Zn superoxide dismutase of Brucella abortus induces protective immunity in BALB/c mice. Infection and immunity. 2003 Sep; 71(9); 4857-61. [PubMed: 12933826].
Vemulapalli et al., 2000: Vemulapalli R, He Y, Cravero S, Sriranganathan N, Boyle SM, Schurig GG. Overexpression of protective antigen as a novel approach to enhance vaccine efficacy of Brucella abortus strain RB51. Infection and immunity. 2000 Jun; 68(6); 3286-9. [PubMed: 10816475].
Gene Information
Gene Name SodC from B. abortus strain 2308
NCBI Gene ID 3827840
Genbank Accession AM040265
Chromosome No II
Locus Tag BAB_RS28905
Gene Starting Position 534068
Gene Ending Position 534589
DNA Sequence
>NC_007624.1:534068-534589 Brucella melitensis biovar Abortus 2308 chromosome II, complete sequence, strain 2308
GATGAAGTCCTTATTTATTGCATCGACAATGGTGCTTATGGCTTTTCCGGCTTTCGCAGAAAGCACGACG
GTAAAAATGTATGAGGCGCTGCCGACCGGACCGGGTAAAGAAGTTGGCACCGTGGTCATTTCCGAAGCCC
CGGGCGGGCTGCACTTCAAGGTGAATATGGAAAAGCTGACGCCGGGCTATCATGGCTTTCATGTTCACGA
AAATCCAAGCTGCGCTCCGGGAGAAAAAGACGGCAAGATCGTACCGGCTCTTGCTGCCGGCGGGCATTAT
GATCCGGGTAATACCCATCACCATTTAGGACCTGAAGGTGATGGACATATGGGCGATTTGCCACGCCTGA
GCGCCAATGCTGACGGCAAGGTGAGTGAAACCGTTGTCGCTCCACATCTCAAGAAATTGGCGGAAATCAA
GCAGCGTTCTTTGATGGTCCATGTCGGAGGGGATAATTATTCCGATAAGCCTGAGCCGCTTGGTGGCGGT
GGTGCCCGTTTTGCCTGCGGCGTGATCGAATA

Protein Information
Protein Name superoxide dismutase [Cu-Zn]
NCBI Protein GI 489062065
Protein Accession WP_002972093
3D structure: PDB ID 2AQM
Protein pI 6.74
Protein Weight 16741.77
Protein Length 173
Protein Sequence
>WP_002972093.1 MULTISPECIES: superoxide dismutase [Cu-Zn] [Brucella]
MKSLFIASTMVLMAFPAFAESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHE
NPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIK
QRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE

Epitope Information
IEDB Linear Epitope