VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


Omp16

General Information
Protegen ID 260
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010973
Taxonomy ID 359391
Molecule Role Protective antigen
Molecule Role Annotation Brucella Omp16 is a protective antigen (Pasquevich et al., 2009).
COG COG2885M, under M: Cell wall/membrane/envelope biogenesis
Related Vaccines(s) B. abortus DNA vaccine encoding RplL and Omp16
References
Pasquevich et al., 2009: Pasquevich KA, Estein SM, GarcĂ­a Samartino C, Zwerdling A, Coria LM, Barrionuevo P, Fossati CA, Giambartolomei GH, Cassataro J. Immunization with recombinant Brucella species outer membrane protein Omp16 or Omp19 in adjuvant induces specific CD4+ and CD8+ T cells as well as systemic and oral protection against Brucella abortus infection. Infection and immunity. 2009; 77(1); 436-445. [PubMed: 18981242].
Gene Information
Gene Name Omp16
NCBI Gene ID 3788229
Genbank Accession AM040264
Chromosome No I
Locus Tag BAB_RS24085
Gene Starting Position 1654432
Gene Ending Position 1654938
DNA Sequence
>NC_007618.1:1654432-1654938 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
TTTACCGTCCGGCCCCGTTGAGAACGGTGACGGCGCGACGGTTCTGCGACCAGCATGTGTCGGCATCGCA
GACGGCAACCGGGCGCTCATTACCGTAGGAAATGGTGCGCATGCGGTTGGTCGGCACACCGCGCGAAGCG
AGGAAGTCGCGGGTGGCGGCAGCACGGCGCTGGCCAAGGGCGAGGTTGTACTCACGCGTGCCGCGCTCGT
CGGCATGGCCTTCGATCGTGATCGAATACTGCGGATAACGCTGCAACCACTGGGCCTGCTTGGAAAGCGT
CTGCTGCGCATCGGCGCGGATCAGCGACGAATCGAGATCGAAGAAGATGCGGTCGCCGACATTAACGGTG
AAGTCCTGCGAGGAGCCCGGCGTTGCAGCGCCTGCACCGAGACCCAGATCACCGGCATTATTCGGAAGGT
TCTTCTTTGACGCACAGCCGGCAACGGCGAGCGACATGAAAAGCGCAATAGCGATCGGGCTACGTGCAAT
CGACTGGATACGGCGCA

Protein Information
Protein Name hypothetical protein
NCBI Protein GI 489056820
Protein Accession WP_002966947
Protein pI 10.24
Protein Weight 17438.15
Protein Length 168
Protein Annotation Synonyms: Omp16, MotY
Protein Sequence
>WP_002966947.1 MULTISPECIES: hypothetical protein [Brucella]
MRRIQSIARSPIAIALFMSLAVAGCASKKNLPNNAGDLGLGAGAATPGSSQDFTVNVGDRIFFDLDSSLI
RADAQQTLSKQAQWLQRYPQYSITIEGHADERGTREYNLALGQRRAAATRDFLASRGVPTNRMRTISYGN
ERPVAVCDADTCWSQNRRAVTVLNGAGR

Vaxign Prediction
Localization(Probability) Outer Membrane
(Prob.=1)
Adhesin Probability 0.388
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope