VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


Omp19

General Information
Protegen ID 259
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010972
Taxonomy ID 359391
Molecule Role Protective antigen
Molecule Role Annotation Brucella Omp19 is a protective antigen (Pasquevich et al., 2009).
References
Pasquevich et al., 2009: Pasquevich KA, Estein SM, GarcĂ­a Samartino C, Zwerdling A, Coria LM, Barrionuevo P, Fossati CA, Giambartolomei GH, Cassataro J. Immunization with recombinant Brucella species outer membrane protein Omp16 or Omp19 in adjuvant induces specific CD4+ and CD8+ T cells as well as systemic and oral protection against Brucella abortus infection. Infection and immunity. 2009; 77(1); 436-445. [PubMed: 18981242].
Gene Information
Gene Name Omp19
NCBI Gene ID 3788831
Genbank Accession AM040264
Chromosome No I
Locus Tag BAB_RS25135
Gene Starting Position 1877306
Gene Ending Position 1877839
DNA Sequence
>NC_007618.1:1877306-1877839 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
ATCAGCGCGACAGCGTCACGGCCTGCCCGCCGGTGGTCTGGCCATCGAAGCGGCCCTGTCCTGAAGAATA
GAGCGAGGCAACCGTACCGCCGTTCGCATCGTAAAGGACGAGTTGCTTGCCATTGACGGCCCAGGAGGCA
AGATTAGCCAGTTCACCGGGGCAGCGCAGCGGGCCTGCGCGATAGCCCTGGCCATATTTGGTCTGCGGCG
TCGCGATCTTGCAGCTCTGACCACCAAGCGAGGCGTTCCAGACGCCAGCCACGGCGCCGGGCGTCAGGTC
CGGTGCGGATGCAGGCGGCAGGCTTGCGACCTGTGTGCCGGATTGCGCGCTCATATCCGTGGAGGGCGCA
TTGGGGAATTGTGTGGGAGAATCAAGATTGCCTTTCTGCACCGTGCCTGCCGGAACAGCATTGACCGGTG
CAGGCGGCGGCGGAGGCGAAACATTATCGAGATTACCAAGCCGGGAGCTCTGGCACCCGGCCAGGACAAT
GCCAGCCGCCGCGAGGCTGAGCAGACTTGCTTTTGAAATTCCCA

Protein Information
Protein Name hypothetical protein
NCBI Protein GI 489054833
Protein Accession WP_002964998
Protein pI 8.86
Protein Weight 16412.87
Protein Length 177
Protein Sequence
>WP_002964998.1 MULTISPECIES: hypothetical protein [Brucella]
MGISKASLLSLAAAGIVLAGCQSSRLGNLDNVSPPPPPAPVNAVPAGTVQKGNLDSPTQFPNAPSTDMSA
QSGTQVASLPPASAPDLTPGAVAGVWNASLGGQSCKIATPQTKYGQGYRAGPLRCPGELANLASWAVNGK
QLVLYDANGGTVASLYSSGQGRFDGQTTGGQAVTLSR

Vaxign Prediction
Localization(Probability) Outer Membrane
(Prob.=1)
Adhesin Probability 0.884
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope