VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


DnaK

General Information
Protegen ID 257
Sequence Strain (Species/Organism) Brucella abortus bv. 1 str. 9-941
VO ID VO_0010970
Taxonomy ID 262698
Molecule Role Protective antigen
Molecule Role Annotation Brucella DnaK is a protective antigen (Delpino et al., 2007b).
COG COG0443O, under O: Posttranslational modification, protein turnover, chaperones
References
Delpino et al., 2007b: Delpino MV, Estein SM, Fossati CA, Baldi PC, Cassataro J. Vaccination with Brucella recombinant DnaK and SurA proteins induces protection against Brucella abortus infection in BALB/c mice. Vaccine. 2007; 25(37-38); 6721-6729. [PubMed: 17686554].
Gene Information
Gene Name DnaK
NCBI Gene ID 3341115
Genbank Accession AE017223
Chromosome No I
Locus Tag BruAb1_2100
Gene Starting Position 2066035
Gene Ending Position 2067948
DNA Sequence
>NC_006932.1:2066035-2067948 Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence
TATGGCTAAAGTTATTGGTATCGATCTGGGAACGACCAACTCCTGCGTTGCCGTCATGGACGGAAAGAAC
GCGAAGGTCATTGAAAATGCAGAAGGTGCACGCACCACCCCTTCGATCATCGCCTTCACCGATGGTGACG
AACGCCTCGCTGGTCAGCCTGCGAAGCGTCAGGCCGTCACCAACCCGGAAGGCACCCTTTTTGCCGTCAA
GCGCCTGATTGGCCGTCGCTATGACGATCCGATGGTCACCAAGGACAAGGATCTTGTTCCTTACAAGATC
GTCAAGGGCGACAATGGCGATGCCTGGGTCGAGGTGCACGGCAAGAAATATTCTCCGTCGCAGATCTCCG
CTATGATCCTTCAGAAGATGAAGGAAACGGCTGAATCCTACCTTGGCGAAACCGTTACGCAGGCCGTCAT
CACGGTTCCGGCCTACTTCAACGACGCCCAGCGTCAGGCCACCAAGGATGCCGGCAAGATCGCCGGTCTG
GAAGTTCTGCGCATCATCAACGAGCCGACCGCGGCTGCGCTTGCCTATGGTCTCGACAAGAGCGAAGGCA
AGACCATCGCTGTCTATGACCTTGGCGGCGGTACTTTCGACGTGTCGGTTCTGGAAATCGGCGACGGCGT
TTTTGAAGTGAAGTCCACCAATGGCGACACGTTCCTTGGCGGTGAAGACTTCGATATTCGTCTGGTCGAA
TATCTGGTTGCCGAGTTCAAGAAGGAAAGTGGCATCGACCTGAAGAACGACAAGCTTGCCCTGCAGCGCC
TCAAGGAAGCTGCCGAAAAGGCCAAGATCGAACTGTCGTCCTCGCAGCAGACCGAAATCAACCTGCCGTT
CATCACGGCTGACCAGACTGGCCCGAAGCATCTGGCGATCAAGCTGTCGCGCGCCAAGTTTGAAAGCCTG
GTCGATGATCTCGTGCAGCGCACGGTCGAGCCGTGCAAGGCGGCGCTCAAGGATGCCGGCCTCAAGGCTG
GCGAAATTGACGAAGTGGTTCTGGTCGGCGGCATGACCCGCATGCCCAAGATTCAGGAAGTCGTGAAGGC
CTTCTTCGGCAAGGAACCGCACAAGGGCGTGAACCCGGATGAAGTCGTGGCCATGGGCGCGGCGATCCAG
GGCGGCGTTTTGCAGGGCGACGTCAAGGACGTGCTGCTGCTCGACGTGACCCCGCTTTCGCTCGGCATTG
AAACGCTGGGCGGCGTGTTCACCCGCCTGATCGAACGCAACACCACTATCCCGACCAAGAAGTCGCAGAC
CTTCTCCACGGCTGAGGACAACCAGTCGGCCGTGACGATCCGCGTCTTCCAGGGCGAGCGTGAAATGGCA
GCCGATAACAAGCTGCTTGGACAGTTCGACCTCGTTGGCATTCCGCCCGCACCGCGCGGTGTGCCGCAGA
TCGAAGTGACCTTCGACATCGACGCCAACGGCATCGTCAACGTTTCGGCCAAGGATAAGGGTACCGGCAA
GGAGCACCAGATCCGCATTCAGGCTTCGGGCGGCCTGAGCGATGCCGACATCGAAAAGATGGTCAAGGAC
GCCGAAGCCAATGCCGAGGCCGACAAGAAGCGTCGTGAGAGCGTCGAAGCCAAGAATCAGGCCGAAAGCC
TGGTCCATTCGACCGAAAAGTCGCTGGCCGAATATGGCGACAAGGTTTCGGCCGATGACAAGAAGGCCAT
TGAGGATGCGATCGCAGCCCTCAAGACCTCGCTTGAAGGTGAAGACGCCGAGGATATCAAGGCGAAGACC
CAGGCCCTTGCCGAAGTTTCCATGAAGCTTGGTCAGGCCATGTACGAAGCAGCGCAGGCTGCCGAAGGTG
CGGGTGCCGAGGGCGGTGAACAGGCCTCTTCGTCCAAGGACGATGTGGTCGATGCCGACTACGAAGAAAT
CGACGACAACAAGAAGTCGTCGTA

Protein Information
Protein Name molecular chaperone DnaK
NCBI Protein GI 62290965
Protein Accession YP_222758
Protein pI 4.59
Protein Weight 63035.04
Protein Length 637
Protein Note heat shock protein 70; assists in folding of nascent polypeptide chains; refolding of misfolded proteins; utilizes ATPase activity to help fold; co-chaperones are DnaJ and GrpE; multiple copies in some bacteria
Protein Sequence
>YP_222758.1 molecular chaperone DnaK [Brucella abortus bv. 1 str. 9-941]
MAKVIGIDLGTTNSCVAVMDGKNAKVIENAEGARTTPSIIAFTDGDERLAGQPAKRQAVTNPEGTLFAVK
RLIGRRYDDPMVTKDKDLVPYKIVKGDNGDAWVEVHGKKYSPSQISAMILQKMKETAESYLGETVTQAVI
TVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKSEGKTIAVYDLGGGTFDVSVLEIGDGV
FEVKSTNGDTFLGGEDFDIRLVEYLVAEFKKESGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPF
ITADQTGPKHLAIKLSRAKFESLVDDLVQRTVEPCKAALKDAGLKAGEIDEVVLVGGMTRMPKIQEVVKA
FFGKEPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQT
FSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGK
EHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRESVEAKNQAESLVHSTEKSLAEYGDKVSADDKKAI
EDAIAALKTSLEGEDAEDIKAKTQALAEVSMKLGQAMYEAAQAAEGAGAEGGEQASSSKDDVVDADYEEI
DDNKKSS

Vaxign Prediction
Localization(Probability) Cytoplasmic
(Prob.=0.997)
Adhesin Probability 0.326
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope