VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


VP30 from Zaire ebolavirus

General Information
Protegen ID 18
Sequence Strain (Species/Organism) Zaire ebolavirus
VO ID VO_0010867
Taxonomy ID 186538
Molecule Role Protective antigen
Molecule Role Annotation VP30 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
Additional Molecule Role Protective antigen
Related Vaccines(s) VRP expressing VP30
References
Wilson et al., 2001: Wilson JA, Bray M, Bakken R, Hart MK. Vaccine potential of Ebola virus VP24, VP30, VP35, and VP40 proteins. Virology. 2001 Aug 1; 286(2); 384-90. [PubMed: 11485406].
Gene Information
Gene Name VP30 from Zaire ebolavirus
NCBI Gene ID 911826
Genbank Accession AF272001
Locus Tag ZEBOVgp5
Gene Starting Position 8287
Gene Ending Position 9739
DNA Sequence
>NC_002549.1:8287-9739 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
TGATGAAGATTAAGAAAAAGGTAATCTTTCGATTATCTTTAATCTTCATCCTTGATTCTACAATCATGAC
AGTTGTCTTTAGTGACAAGGGAAAGAAGCCTTTTTATTAAGTTGTAATAATCAGATCTGCGAACCGGTAG
AGTTTAGTTGCAACCTAACACACATAAAGCATTGGTCAAAAAGTCAATAGAAATTTAAACAGTGAGTGGA
GACAACTTTTAAATGGAAGCTTCATATGAGAGAGGACGCCCACGAGCTGCCAGACAGCATTCAAGGGATG
GACACGACCACCATGTTCGAGCACGATCATCATCCAGAGAGAATTATCGAGGTGAGTACCGTCAATCAAG
GAGCGCCTCACAAGTGCGCGTTCCTACTGTATTTCATAAGAAGAGAGTTGAACCATTAACAGTTCCTCCA
GCACCTAAAGACATATGTCCGACCTTGAAAAAAGGATTTTTGTGTGACAGTAGTTTTTGCAAAAAAGATC
ACCAGTTGGAGAGTTTAACTGATAGGGAATTACTCCTACTAATCGCCCGTAAGACTTGTGGATCAGTAGA
ACAACAATTAAATATAACTGCACCCAAGGACTCGCGCTTAGCAAATCCAACGGCTGATGATTTCCAGCAA
GAGGAAGGTCCAAAAATTACCTTGTTGACACTGATCAAGACGGCAGAACACTGGGCGAGACAAGACATCA
GAACCATAGAGGATTCAAAATTAAGAGCATTGTTGACTCTATGTGCTGTGATGACGAGGAAATTCTCAAA
ATCCCAGCTGAGTCTTTTATGTGAGACACACCTAAGGCGCGAGGGGCTTGGGCAAGATCAGGCAGAACCC
GTTCTCGAAGTATATCAACGATTACACAGTGATAAAGGAGGCAGTTTTGAAGCTGCACTATGGCAACAAT
GGGACCGACAATCCCTAATTATGTTTATCACTGCATTCTTGAATATTGCTCTCCAGTTACCGTGTGAAAG
TTCTGCTGTCGTTGTTTCAGGGTTAAGAACATTGGTTCCTCAATCAGATAATGAGGAAGCTTCAACCAAC
CCGGGGACATGCTCATGGTCTGATGAGGGTACCCCTTAATAAGGCTGACTAAAACACTATATAACCTTCT
ACTTGATCACAATACTCCGTATACCTATCATCATATATTTAATCAAGACGATATCCTTTAAAACTTATTC
AGTACTATAATCACTCTCGTTTCAAATTAATAAGATGTGCATGATTGCCCTAATATATGAAGAGGTATGA
TACAACCCTAACAGTGATCAAAGAAAATCATAATCTCGTATCGCTCGTAATATAACCTGCCAAGCATACC
TCTTGCACAAAGTGATTCTTGTACACAAATAATGTTTTACTCTACAGGAGGTAGCAACGATCCATCCCAT
CAAAAAATAAGTATTTCATGACTTACTAATGATCTCTTAAAATATTAAGAAAA

Protein Information
Protein Name mRNA
NCBI Protein GI 10313997
Protein Accession NP_066249
3D structure: PDB ID 2I8B
Protein pI 8.23
Protein Weight 31130.81
Protein Length 288
Protein Sequence
>NP_066249.1 minor nucleoprotein [Zaire ebolavirus]
MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKD
ICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGP
KITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEV
YQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTC
SWSDEGTP

Vaxign Prediction
Localization(Probability)
(Prob.=0)
Adhesin Probability 0.178
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope