VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


AsnC

General Information
Protegen ID 1103
Sequence Strain (Species/Organism) Brucella abortus 2308
Taxonomy ID 359391
Molecule Role Protective antigen
Molecule Role Annotation Mice given BAB1_1688 (AsnC) plus adjuvant could provide protection against virulent B. abortus infection, similarly with the known protective antigen Cu-Zn SOD and the license vaccine S19 (Fu et al., 2012).
Related Vaccines(s) Recombinant B. abortus AsnC protein with CFA/IFA adjuvant
References
Fu et al., 2012: Fu S, Xu J, Li X, Xie Y, Qiu Y, Du X, Yu S, Bai Y, Chen Y, Wang T, Wang Z, Yu Y, Peng G, Huang K, Huang L, Wang Y, Chen Z. Immunization of Mice with Recombinant Protein CobB or AsnC Confers Protection against Brucella abortus Infection. PloS one. 2012; 7(2); e29552. [PubMed: 22383953].
Gene Information
Gene Name AsnC
NCBI Gene ID 3788213
Genbank Accession JMRZ01000003
Chromosome No I
Locus Tag BAB_RS24000
Gene Starting Position 1633929
Gene Ending Position 1634399
DNA Sequence
>NC_007618.1:1633929-1634399 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
TCTAACGCCCATCCAGCGGGACGGCTGTGGTGTCCTTGATCTCTTCCATCACGAAAGAGGCCGATACATC
CGATAGCGGTACACAGGCTATGAGGCGCTGGTAGAGCCGGTCATAAGCTCTGACATCGGAAATGCGTGCC
TTCAGCACATAGTCCAGATCGCCGGTCATGCGATAGGCGCCGACGATTTCCGGGAAGCGAGCCACGGCAG
CGCGGAATTTGTTCAGCCATTCGGGATCATGGGCGGAGGTGCGCACCAGAATGAAAACCGAGAGGCCATA
GCCGACCATTTCCGCATCCACCAGCGCCACGCGACCTTTGATGACGCCATCGTCTTCCATGCGCTTTACG
CGCCGCCAGCAGGCATTGCGCGAAAGATTCACCCGTTCGGAAAGGGAATCAACCGACAAAGTGCCGTCGT
TTTGCAACTCAGCCAGGATTTTTCGGTCTATATCGTCCATAGATGCTGTCA

Protein Information
Protein Name ArsR family transcriptional regulator
NCBI Protein GI 489054600
Protein Accession WP_002964767
Protein pI 5.32
Protein Weight 15857.78
Protein Length 156
Protein Sequence
>WP_002964767.1 MULTISPECIES: Lrp/AsnC family transcriptional regulator [Brucella]
MTASMDDIDRKILAELQNDGTLSVDSLSERVNLSRNACWRRVKRMEDDGVIKGRVALVDAEMVGYGLSVF
ILVRTSAHDPEWLNKFRAAVARFPEIVGAYRMTGDLDYVLKARISDVRAYDRLYQRLIACVPLSDVSASF
VMEEIKDTTAVPLDGR

Vaxign Prediction
Localization(Probability) Cytoplasmic
(Prob.=0.926)
Adhesin Probability 0.147
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope