VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


cobB

General Information
Protegen ID 1102
Sequence Strain (Species/Organism) Brucella abortus 2308
Taxonomy ID 359391
Molecule Role Protective antigen
Molecule Role Annotation Mice given BAB1_1316 (CobB) plus adjuvant could provide protection against virulent B. abortus infection, similarly with the known protective antigen Cu-Zn SOD and the license vaccine S19 (Fu et al., 2012).
Related Vaccines(s) Recombinant B. abortus CobB protein with CFA/IFA adjuvant
References
Fu et al., 2012: Fu S, Xu J, Li X, Xie Y, Qiu Y, Du X, Yu S, Bai Y, Chen Y, Wang T, Wang Z, Yu Y, Peng G, Huang K, Huang L, Wang Y, Chen Z. Immunization of Mice with Recombinant Protein CobB or AsnC Confers Protection against Brucella abortus Infection. PloS one. 2012; 7(2); e29552. [PubMed: 22383953].
Gene Information
Gene Name cobB
NCBI Gene ID 3787893
Genbank Accession JMRZ01000005
Chromosome No I
Locus Tag BAB_RS22225
Gene Starting Position 1271743
Gene Ending Position 1273053
DNA Sequence
>NC_007618.1:1271743-1273053 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
CTCACGCCGCTTCTCCGCTAAAATCAATGACATGCATGAAGGAGCCGGAGACGGAACCAACCCGCAAGCC
CGCTTCGCCAAGGTTCTCGCCCGATGCATCGCGCACCCGGAACAGGCGGTCGGCCTTTTCTTCCCGCACG
ATGCTTGCATAATGGAATTCATGCGCTTTCAAAGGCATGTCCCACGGCAATCCGCCAAGCGGCTCCAGCA
GGCGATAGCCAAGATGCAGTTTCCGCCTGGCAAAGCTCGTTTCCAATGGCAAAAGCCCCAGCATGGGATG
GTGAACGCCTGCCGCATCCTCCAGTGTTTTCCCGAGGACCATATAGCCGCCGCACTCGCCATAGACCGTG
ACGCCACGCGCGGCAGCGTCCCCTATCGCCGTGCGGAAACGGGATGCACCGGCCAATCGTTGCGCATGAA
GTTCTGGATAACCACCGGGAAGATAGATTGCATCCGCATCTGCCTTCGGTGCTTCATCTGCCAGCGGGGA
AAAGAAAGAGATTTCCGCACCCCGCCTGCGCCAGCCTTCAAAAAGATGCATATAGGCAAAAGCAAAGGCA
TCGTCCCGCGCCACGGCAATGCGGTTTCCAAGCGGTTTCAGACGCGCGACATTGGCCATGGCGTCATAGC
GCTTCGGGCGTAGCCAGATGGTCTGAAGCGCATCCATGTCGATATGCGCTTCCATCACATCGGCCGCTTG
TTCGAGAAAGCTTTCAAGACCGGCATGTTCGTCCGCCTGCACCAGCCCCAGATGCCTTTCCGGCAAGGAA
AGTGCCGGATCTCGCGGCAGCGCGCCCAGAACCGGGACGCCAAGGGGTGCCAGAGCGCCCCGCAGCATGG
CTTCATGGCGGGGACTTCCGACACGATTGAGAATGACACCCTCAATCAGCACATCCTTGCGAAACTGGCT
GAAACCCCACACCAGCGCCGCGATGGAGTGGGATTGCCGGGCGCAATCCACCACCAGCACGACTGGCAAA
TCCAGAAGCCGCGCCAGATCGGCAGAAGAGCCCTTACCGTCAATCGCCCCGTCGAAAAGCCCCATCATGC
CTTCGGCGACAAGAACACGCGCGCCGCTTTCCGTCATGCGGGAGGAAAGCGCACTGATGAGTTCCGGTCG
CATGGCCCAGGGGTCGAGATTGAAACAATCCACGCCACTCGCCGCCCTGTGATAGGCGGGGTCGATATAA
TCCGGCCCGGCCTTCACCGGCGCAAGCACCTCGCCCCTGCGTTTCAGGGCGCGCAACAAACCCAAGGTCA
CGGTCGTCTTGCCCGACCCGGAGGCCGGTGCGGCAATCATGAATCCCTTCA

Protein Information
Protein Name hydrogenobyrinate a,c-diamide synthase
NCBI Protein GI 489054238
Protein Accession WP_002964414
Protein pI 6.89
Protein Weight 44156.43
Protein Length 436
Protein Note responsible for the amidation of carboxylic groups at position A and C of cobyrinic acid or hydrogenobrynic acid
Protein Sequence
>WP_002964414.1 MULTISPECIES: hydrogenobyrinate a,c-diamide synthase [Brucella]
MKGFMIAAPASGSGKTTVTLGLLRALKRRGEVLAPVKAGPDYIDPAYHRAASGVDCFNLDPWAMRPELIS
ALSSRMTESGARVLVAEGMMGLFDGAIDGKGSSADLARLLDLPVVLVVDCARQSHSIAALVWGFSQFRKD
VLIEGVILNRVGSPRHEAMLRGALAPLGVPVLGALPRDPALSLPERHLGLVQADEHAGLESFLEQAADVM
EAHIDMDALQTIWLRPKRYDAMANVARLKPLGNRIAVARDDAFAFAYMHLFEGWRRRGAEISFFSPLADE
APKADADAIYLPGGYPELHAQRLAGASRFRTAIGDAAARGVTVYGECGGYMVLGKTLEDAAGVHHPMLGL
LPLETSFARRKLHLGYRLLEPLGGLPWDMPLKAHEFHYASIVREEKADRLFRVRDASGENLGEAGLRVGS
VSGSFMHVIDFSGEAA

Vaxign Prediction
Localization(Probability) Cytoplasmic
(Prob.=0.997)
Adhesin Probability 0.101
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope