VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


B. melitensis M5 P39

General Information
Protegen ID 110
Sequence Strain (Species/Organism) B. melitensis strain M5
VO ID VO_0010948
Taxonomy ID 1004957
Other Database IDs CDD:224567
CDD:304360
Molecule Role Protective antigen
Molecule Role Annotation The 39-kDa protein is immunogenic.
Related Vaccines(s) B. melitensis P39 protein vaccine
References  
Gene Information
Gene Name B. melitensis M5 P39
Genbank Accession EF189139
DNA Sequence
>gi|122892473|gb|EF189139.1| Brucella melitensis strain M5 immunogenic 39-kDa protein gene, complete cds
ATGGGTACGGCTTCCTGTGGTTTGCTCGCCGGAATGGCGCCTGTTGCCAATGCGCAGGAAAAGCAGAATG
TCGAGGTTCTGCACTGGTGGACGTCCGGCGGCGAAGCGTCCGCGCTTGAAGTTTTGAAAAAAGATCTTGA
AAGCAAGGGCATTAGCTGGACCGATATGCCGGTTGCAGGTGGCGGCGGCACGGAAGCCATGACCGTTTTG
CGCGCGCGCGTTACCGCAGGCAATGCGCCAACCGCGGTGCAGATGCTGGGTTTTGACATTCGCGACTGGG
CGGAGCAGGGCGCACTCGGCAATCTCGATACGGTTGCTTCCAAGGAAGGCTGGGAAAAGGTTATTCCGGC
TCCCTTGCAGGAATTTGCCAAATATGACGGCCACTGGATTGCTGCGCCCGTCAATATTCACTCCACCAAC
TGGATGTGGATCAACAAGGCTGCTCTCGACAAGGCTGGCGGCAAGGAGCCGACCAATTGGGATGAGCTGA
TTGCGCTTCTCGACAATTTCAAGGCGCAGGGCATTACGCCGATCGCGCATGGCGGCCAGCCGTGGCAGGA
TGCAACCATTTTCGATGCGGTTGTTCTTTCATTCGGCCCGGATTTCTACAAGAAGGCCTTCATCGATCTC
GACCCGGAAGCACTGGGCAGCGATACCATGAAGCAGGCCTTCGACCGCATGTCCAAGCTTCGCACCTATG
TTGATGACAACTTCTCCGGCCGTGACTGGAACCTTGCTTCGGCCATGGTTATCGAAGGCAAGGCCGGTGT
CCAGTTCATGGGCGACTGGGCGAAGGGCGAGTTCCTCAAGGCGGGCAAGAAGCCGGGTGAGGATTTCGTC
TGCATGCGTTATCCGGGCACGCAGGGTGCTGTCACTTTCAATTCCGGCATGTTCGCCATGTTCAAGGTTT
CGGAAGACAAGGTTCCCGCACAGCTTGAAATGGCTTCGGCGATTGAAAGCCCTGCCTTCCAGTCTGCCTT
TAATGTGGAGAAGGGGTCGGCCCCGGCACGCACGGATGTGCCCGATACCGCTTTCGATGCCTGTGGCAAG
AAGACCATTGCCGATGTCAAGGAAGCAAACAGCAAGGGCACTCTGCTTGGCTCCATGGCGCATGGCTATG
CCAATCCGGCTGCCGTGAAGAATGCGATCTACGACGTCGTGACCCGCCAGTTCAACGGCCAGCTTTCTTC
GGAAGATGCCGTCAAGGAACTCGTTGTGGCGGTTGAAGCCGCAAAATAAGGCCACGCGGAAACGTCCGGG
GGAACCTCCCGGACGTTTTTCCTGCGTGCTCCAGCAGAAGCGCATAGGCGGTTGGCGCAGCTAACCGGCA
CTTACGACGGAATTGCATGCCGATATGCCCGCCTCACCATCCGAGGCGCGTTTCGTGGGACATAGAGC
Protein Information
Protein Name immunogenic 39-kDa protein
NCBI Protein GI 122892474
Protein Accession ABM67295
Protein pI 4.69
Protein Weight 40682.69
Protein Length 483
Protein Note biovar: 1 str. M5
Protein Sequence
>ABM67295.1 immunogenic 39-kDa protein [Brucella melitensis bv. 1 str. M5]
MAPVANAQEKQNVEVLHWWTSGGEASALEVLKKDLESKGISWTDMPVAGGGGTEAMTVLRARVTAGNAPT
AVQMLGFDIRDWAEQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDK
AGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFIDLDPEALGSDTMK
QAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKAGKKPGEDFVCMRYPGTQGAV
TFNSGMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVEKGSAPARTDVPDTAFDACGKKTIADVKEANS
KGTLLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVVAVEAAK

Vaxign Prediction
Localization(Probability) Periplasmic
(Prob.=0.944)
Adhesin Probability 0.506
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope