VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


EBOV NP

General Information
Protegen ID 11
Sequence Strain (Species/Organism) Reston ebolavirus
VO ID VO_0010859
Taxonomy ID 186539
Molecule Role Protective antigen
Related Vaccines(s) GP-VRP , NP-VRP
References  
Gene Information
Gene Name EBOV NP
NCBI Gene ID 955194
Genbank Accession AF522874
Locus Tag REBOVgp1
Gene Starting Position 55
Gene Ending Position 3012
DNA Sequence
>NC_004161.1:55-3012 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
TGAGGAAGATTAACAGTTTTCCTCAGTTTAAGATATACACTGAAATTGAGATTGAGATTCTCCTCTTTGC
TATTCTGTAACTTTCCCTGGTTGTGACAATTGAATCAGTTTTATCTATTACCAATTACCATCAACATGGT
ATGTCTAGTGATCTTGGGACTCTTCTTCATCTGGTTTTTCCTAGAGCTCTGAATCCATTTTGCGAGAAGT
TCATCCAAACGACCCAGTGTCTGAAAATACAAAAGGTTCCCCTTTCCGTCAAGTTTAAGGGGTTGTTTTG
ATTGTGTGTAGATTTTATAATCCTAGAGTGCCAAGGAGTTGCGTGTCATCATTGATTGGGAAGATCAAGG
AAACAATTTGTTCCAATAATATCGTACATCTTGACTAAGTCGAACAAGGGGAAGTCGATATGGATCGTGG
GACCAGAAGAATCTGGGTGTCGCAAAATCAAGGTGATACTGATTTAGATTATCATAAAATTTTGACAGCT
GGCCTTACTGTTCAACAGGGAATTGTCAGGCAGAAAATAATTTCTGTATATCTTGTTGATAACTTGGAGG
CTATGTGTCAATTGGTAATACAAGCCTTTGAGGCCGGAATTGATTTCCAAGAAAATGCCGACAGCTTCCT
TCTGATGCTTTGCCTACATCATGCTTACCAAGGTGACTATAAATTGTTCTTGGAGAGCAATGCTGTACAG
TATTTGGAAGGTCATGGATTCAAATTTGAGCTCCGGAAGAAGGACGGTGTCAATCGGCTCGAGGAATTGC
TTCCTGCTGCAACGAGTGGAAAAAACATCAGGCGTACGTTGGCCGCACTGCCTGAAGAGGAGACTACAGA
AGCAAATGCAGGGCAATTTCTCTCATTTGCGAGTTTGTTTCTTCCCAAACTGGTTGTGGGAGAGAAGGCT
TGCTTGGAAAAAGTCCAGCGACAAATTCAGGTTCATGCAGAACAGGGTTTAATTCAATATCCCACTGCAT
GGCAATCAGTTGGACACATGATGGTAATCTTCAGATTGATGAGGACTAATTTCTTGATTAAATATTTACT
GATCCACCAGGGTATGCATATGGTAGCTGGCCACGATGCCAATGATGCTGTCATTGCTAATTCAGTTGCT
CAGGCTCGCTTTTCAGGACTCCTAATTGTCAAAACCGTTCTTGATCATATTCTGCAAAAAACCGACCAAG
GAGTAAGACTTCACCCTTTGGCCCGAACAGCCAAAGTGCGTAATGAGGTTAATGCATTTAAGGCCGCCCT
AAGCTCACTTGCTAAGCATGGGGAATATGCCCCTTTTGCTCGCCTTCTCAATCTCTCGGGAGTTAACAAC
CTAGAACATGGTCTCTACCCACAGTTATCAGCAATTGCTCTTGGAGTTGCCACAGCACATGGTAGCACCC
TTGCAGGAGTTAATGTTGGTGAGCAGTATCAGCAGCTTAGAGAGGCTGCCACTGAAGCTGAGAAGCAACT
CCAACAATATGCTGAGTCCAGAGAACTCGACAGCCTAGGCCTGGACGATCAGGAAAGAAGAATACTAATG
AACTTCCATCAGAAGAAAAACGAAATTAGTTTCCAGCAGACCAATGCAATGGTAACCCTTAGGAAAGAGC
GACTGGCTAAATTAACAGAAGCTATAACGCTGGCCTCAAGACCTAACCTCGGGTCTAGACAAGACGACGG
CAATGAAATACCGTTCCCTGGGCCTATAAGCAACAACCCAGACCAAGATCATCTGGAGGATGATCCTAGA
GACTCCAGAGACACCATCATTCCTAATGGTGCAATTGACCCCGAGGATGGTGATTTTGAAAATTACAATG
GCTATCATGATGATGAAGTTGGGACGGCAGGTGACTTGGTCCTGTTCGATCTTGACGATCATGAGGATGA
CAATAAAGCTTTTGAGCCACAGGACAGCTCGCCACAATCCCAAAGGGAAATAGAGAGAGAAAGATTAATT
CATCCACCCCCAGGCAACAACAAGGACGACAATCGAGCCTCAGACAACAATCAACAATCAGCAGATTCTG
AGGAACAAGGAGGTCAATACAACTGGCACCGAGGCCCAGAACGTACGACCGCCAATCGAAGACTCTCACC
AGTGCACGAAGAGGACACCCTTATGGATCAAGGTGATGATGATCCCTCAAGCTTACCTCCGCTGGAATCT
GATGATGACGATGCATCAAGTAGCCAACAAGATCCCGATTATACAGCTGTTGCCCCTCCTGCTCCTGTAT
ACCGCAGTGCAGAAGCCCACGAGCCTCCCCACAAATCCTCGAACGAGCCAGCTGAAACATCACAATTGAA
TGAAGACCCTGATATCGGTCAATCAAAGTCTATGCAAAAATTAGAAGAGACATATCACCATCTGCTGAGA
ACTCAAGGTCCATTTGAAGCCATCAATTATTATCACATGATGAAGGATGAGCCGGTAATATTTAGCACTG
ATGATGGGAAGGAATACACCTACCCGGATTCACTTGAGGAAGCCTATCCTCCATGGCTCACCGAGAAAGA
ACGACTGGACAAAGAGAATCGCTACATTTACATAAATAATCAACAGTTCTTCTGGCCTGTCATGAGTCCC
AGAGACAAATTTCTTGCAATCTTGCAGCACCATCAGTAACCACAGCACAAAGCGCGGTCCACTTCGTAAA
GCTAAATACACTTAAGACTTGACCGATTCATCTACAAAAACTAATCCATTATAACTTATTAGTGCTACTT
TTCTATAAGTGATTCTTAATCTAAGGCCATTAAGAGTTTAAGTAATATACATATACACTTACACCGGTCT
ATCCAAGATGTGGCTCAATGTTCTTGATTTGAACATAGTCATAAGGGGATAAATAATACTTTATATTTCT
GATTGTGGATTGACCCATTCTGCTTAAAATGCTTCGCCCATTGAAAATGTGATCTAATAGATAGCCCTGA
CTAGACAAATTAAGAAAA

Protein Information
Protein Name mRNA
NCBI Protein GI 22789223
Protein Accession NP_690580
Protein pI 4.69
Protein Weight 80076.91
Protein Length 739
Protein Sequence
>NP_690580.1 nucleoprotein [Reston ebolavirus]
MDRGTRRIWVSQNQGDTDLDYHKILTAGLTVQQGIVRQKIISVYLVDNLEAMCQLVIQAFEAGIDFQENA
DSFLLMLCLHHAYQGDYKLFLESNAVQYLEGHGFKFELRKKDGVNRLEELLPAATSGKNIRRTLAALPEE
ETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLI
KYLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQKTDQGVRLHPLARTAKVRNEVNAF
KAALSSLAKHGEYAPFARLLNLSGVNNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEA
EKQLQQYAESRELDSLGLDDQERRILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITLASRPNLGSR
QDDGNEIPFPGPISNNPDQDHLEDDPRDSRDTIIPNGAIDPEDGDFENYNGYHDDEVGTAGDLVLFDLDD
HEDDNKAFEPQDSSPQSQREIERERLIHPPPGNNKDDNRASDNNQQSADSEEQGGQYNWHRGPERTTANR
RLSPVHEEDTLMDQGDDDPSSLPPLESDDDDASSSQQDPDYTAVAPPAPVYRSAEAHEPPHKSSNEPAET
SQLNEDPDIGQSKSMQKLEETYHHLLRTQGPFEAINYYHMMKDEPVIFSTDDGKEYTYPDSLEEAYPPWL
TEKERLDKENRYIYINNQQFFWPVMSPRDKFLAILQHHQ

Vaxign Prediction
Localization(Probability)
(Prob.=0)
Adhesin Probability 0.217
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope