Chlamydophila abortus 83555 Abortion and fetal death C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans (Wiki: Chlamydophila abortus). Chlamydophila abortus is a species in Chlamydiae that causes abortion and fetal death in mammals, including humans. Chlamydophila abortus was previously classified as Chlamydia psittaci along with all Chlamydiae except Chlamydia trachomatis. This was based on a lack of evident glycogen production and on resistance to the antibiotic sulfadiazine. In 1999 C. psittaci and C. abortus were recognized as distinct species based on differences of pathogenicity and DNA–DNA reassociation. C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans. Infected females shed bacteria near the time of ovulation, so C. abortus is transmitted orally and sexually among mammals. All C. abortus strains were isolated or PCR-amplified from placenta or fetal organs after spontaneous abortion. C. abortus infection generally remains inapparent until an animal aborts late in gestation or gives birth to a weak or dead foetus (Wiki: Chlamydophila abortus). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 C. abortus DNA vaccine encoding CAB049 VO_0011526 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus CAB049 putative penicillin-binding protein DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). C. abortus DNA vaccine encoding CAB613 VO_0011527 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus CAB613 putative peptidase DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). C. abortus DNA vaccine encoding DnaK VO_0011518 DNA vaccine Research pcDNA3.1 Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus molecular chaperone DnaK DNA vaccine construction The dnaK gene was amplified by the polymerase chain reaction (PCR) and cloned in the appropriate vectors. PCR was performed using chlamydial genomic DNA (80 ng) as the template. The resulting fragment was inserted into the pcDNA3.1 (Invitrogen) eukaryotic vaccinal vector carrying the human cytomegalovirus immediate early-promoter and the bovine growth hormone polyadenylation signal after linearization by BamHI-XbaI double digestion to generate pcDNA3.1::DnaK. pcDNA3.1::DnaK and pcDNA3.1 control plasmid were purified after an overnight Luria Bertani (LB) culture of recombinant DH5a E. coli using the EndoFreeâ„¢ (Héchard et al., 2002). OF1 Swiss Prior to DNA immunization, each mouse was injected with cardiotoxin (Latoxan, Rosans, France) into the tibialis anterior muscles of both ind legs. Cardiotoxin induces a local inflammation and enhances the uptake of plasmid DNA. Five days later, the mice were anesthetized by intraperitoneal injection of ketamine and xylazine (80 and 8 mg/kg of body weight, respectively) and immunized with pcDNA3.1 or pcDNA3.1::DnaK plasmids by intramuscular injections (50 mg in each tibialis anterior). The mice were boosted in the same way at days 21 and 42, mated at day 51 and challenged at day 63 by an intraperitoneal injection of 2 ´ 10^5 plaque forming units (pfu) of C. abortus AB7 (Héchard et al., 2002). In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002). Four groups of 16 non-pregnant mice were made for immunological trials. Non-pregnant mice were used in order to collect samples without affecting the pregnancy of the mice. Moreover, a good vaccine must be able to protect pregnant and non-pregnant animals. As for the mice of the abortion test, these non-pregnant mice were immunized with the 1B vaccine, pcDNA3.1 or pcDNA3.1::DnaK.One additional group was immunized by PBS (same quantity, site and time as the DNA injections) and consequently was related as the virulence control group (Héchard et al., 2002). In non-pregnant mice, the dnaK vaccine induced a specific humoral response with the predominant serum IgG2a isotope. No antibody response was detected in non-immunized mice or with the control plasmid. Increases in serum IgG2a were seen at day 41, increasing until day 61 with a drop on day 68 to levels similar to those seen on day 41 (Héchard et al., 2002). C. abortus DNA vaccine encoding DnaX VO_0011519 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus DNA polymerase III subunit gamma/tau antigen dnaX DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). C. abortus DNA vaccine encoding GatA/GatB VO_0011520 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus Glu-tRNA Gln Amidotransferase gatA and gatB DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA/gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). C. abortus DNA vaccine encoding GatC VO_0011428 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus aspartyl/glutamyl-tRNA amidotransferase subunit C DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). C. abortus DNA vaccine encoding MOMP VO_0011430 DNA vaccine Research pcDNA3.1 (Invitrogen) Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus major outer membrane protein omp1 DNA vaccine construction The momp (omp1) gene was amplified by PCR and cloned into the vector pcDNA3.1 (Invitrogen) carrying the human cytomegalovirus immediate early promoter and the bovine growth hormone polyadenylation signal. The PCR was performed using chlamydial genomic DNA (80 ng) as template with dNTPs (200 µM each), specific primers (1 µM each) and 1 U Pfu DNA polymerase (Promega) in a Perkin Elmer 9600 thermocycler. The resulting fragment was inserted into the vector pcDNA3.1 after linearization by EcoRI/XhoI double digestion to generate pcDNA3.1 : : MOMP. The plasmid pcDNA3.1 : : MOMP and the pcDNA3.1 control plasmid were purified after an overnight Luria–Bertani culture of recombinant Escherichia coli DH5 using the EndoFree Plasmid Mega kit (Qiagen). Plasmid DNA was dissolved at 1 µg µl-1 in endotoxin-free PBS (Sigma) (Héchard et al., 2003). OF1 Swiss Prior to DNA immunization, each mouse was injected with cardiotoxin (Latoxan) into the tibialis anterior muscles of both hind legs to enhance the uptake of plasmid DNA (Davis et al., 1993). Five days later, mice were anaesthetized by an intraperitoneal injection of ketamine and xylazine (respectively 80 and 8 mg kg-1 body weight) and immunized with pcDNA3.1 : : MOMP plasmid by intramuscular injections (50 µg in each tibialis anterior). Mice were boosted in the same way at days 21 and 42. The negative-control mice were immunized intramuscularly with endotoxin-free PBS (virulence control) or pcDNA3.1 plasmid. Positive-control mice were immunized with one subcutaneous injection of 4 x 10^4 p.f.u. of the live attenuated 1B vaccine at day 1 (Héchard et al., 2003). The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003). The five groups of pregnant mice were mated at day 44. Non-pregnant and pregnant mice were challenged at day 58 by an intraperitoneal injection of 4 x 10^4 p.f.u. C. abortus AB7. One group of pregnant mice neither immunized nor challenged was kept as a control for the pregnancy (gestation control) (Héchard et al., 2003). In non-pregnant mice, the MOMP DNA vaccine elicited a specific humoral response with predominantly serum IgG2a antibodies, suggesting a Th1-type immune response. No antibody response was detected in non-immunized mice or mice immunized with the control plasmid. The anti-MOMP IgG titre reached a maximum in the non-pregnant mice immunized with pcDNA3.1 : : MOMP after the third DNA injection (day 56) and decreased after challenge (day 63) (Héchard et al., 2003). C. abortus DNA vaccine encoding OmlA VO_0011429 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus omlA DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). C. abortus DNA vaccine Pomp90A VO_0011431 DNA vaccine Research pCMVi-UB Intramuscular injection (i.m.) Intramuscular injection (i.m.) C. abortus polymorphic outer membrane protein 90A (pomp90A) DNA vaccine construction To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005). BALB/c Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005). Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005). In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005). licensed Chlamydophila abortus infection human vaccine Generic Unknown VO_0001085 Inactivated or "killed" vaccine Licensed A generic representation of vaccines utilized to prevent Chlamydophila abortus infection in humans, typically employing inactivated bacterial preparations to induce protective immunity and reduce the risk of abortion and fetal death. Ovilis Enzovax Ovilis Enzovax Intervet VO_0000838 Live, attenuated vaccine Licensed Intramuscular injection (i.m.) Live temperature-sensitive mutant strain for subcutaneous or intramuscular injection(Chalmers et al., 1997) Intramuscular injection (i.m.) CAB049 putative penicillin-binding protein Chlamydophila abortus VO_0011059 62184696 CDD:332066 218497 ? penicillin-binding protein 7.02 116990.97 1177 Penicillin-binding Protein dimerisation domain; cl27245 >YP_219481.1 penicillin-binding protein [Chlamydophila abortus S26/3] MKSPKKRRSYLTVPEKTNRLLSGIIVALAIIAVRLWHLAVVEHDQKLEEAYKPQKRVIPELIERATICDR FGKVLAENKMQYDVSVAYSAIRDLPTRAWRARADGTRELIPVRKNYIARLAQLLAQELHLDKDTIEDNIH AKASVLGSVPYVVQANVSERTYLGLKMMMKHWPGLHVEPSVRRYYPMGKTASDILGYVGPISAQEYKSVT HELSKLRECVRAYEEGENPKFPEGLASIDQVRSLLNSLENNAYSLNALVGKVGIEAYCDGSLRGQLGKKT VLVDRRGNFIQGLHEVEAISGKKLQLTLSTELQAFADALLLDHEKTEQFRSAQSLKKQKFLPPLFPWIKG GAIIALDPNNGQILAMASSPRYHNNDFIDIRDADSEARSAVYRWLENTEHIAEVYDRKVPLRRERRSSLT GLCYDEELSLTFDYFLDFILPNTSEVKSVIQRYGTVHNAVKIQHAMERLLEVFSYSEGHCSCSSIFDAVF PVEQEHIAIGRVISIKQQQWIARCHKAHEQEIEEIKQELEPFFAELPANYDKLLLVDLFQLVVDPSKIDP ELLASVASFSLSEFFECQGHYVALRSAFSKIVEDIFTEVDFKEWRKLYFAKFLEVKRKEENERKQRYPTP YVDYLVEEQRAQYQDFRRCYLDRFLAYLLSGQGDIENQKAYYEALSVWKRELENGAHQALPWYEHYEFLK QKFSDSSIDLLRLFVSFREFLELQRPLYGNYAPMLTRNVPQKEQDLAAAFYPTYGYGYLRSHAFGQAATL GSIFKLVSAYSVLSQEVMRGNVDVDYLSRLLVIIDRKSFGYASTKPHVGFFKDGTPIPSFYRGGILPKND YSGRGRIDLISALEMSSNPYFSLLVGEYLSDPEDLCHAAALFGFGEKTGVGLLGEYAGAVPQDVAYNRSG LYATAIGQHTLIVTPLQTAVMMAALVNGGTVYVPSLVLGEWDGEEFSPTPPMKKRDVFMPECITELFKSG MHNVIWGNYGTTRSIRDQFSPELLTRIIGKTSTAESIVRVGLDRQYGSMKMKHVWFAAVGFSDEELMHPD IVVIVYLRLGEFGRDAAPIAVKMIEKWENIRKKEKFSAMN Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) [Ref1052:Stemke-Hale et al., 2005]. CAB613 putative peptidase Chlamydophila abortus VO_0011061 62185225 CDD:189015 218497 ? peptidase 6.33 68106.03 671 Peptidase family M3B Oligopeptidase F (PepF); cd09608 >YP_220010.1 peptidase [Chlamydophila abortus S26/3] MSVEFNKQQVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKTDGSPTWPALQATQYQLDNSESLLSL LTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSA PCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHAL ASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYT NLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQSKEKKYTFQEAVDLIYTSLSPLGTEYIDTL KQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDA QYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPL TEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNS YLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection [Ref1052:Stemke-Hale et al., 2005]. dnaK Chlamydophila abortus VO_0010882 26006347 CDD:234715 83555 ? DnaK 4.71 67356.62 707 molecular chaperone DnaK; Provisional; PRK00290 >AAN77259.1 DnaK [Chlamydia abortus] MSEQKKSSKIIGIDLGTTNSCVSVMEGGQAKVIVSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNPAKT LASTKRFIGRKYSEVESEIKTVPYQVASGSNGDVVFPIDGKQFTPEEIGAQVLIKMKETAEAYLGEPVTE AVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKAGDKKIAVFDLGGGTFDISILEIG DGVFEVLSTNGDTHLGGDDFDEVIIKWMIEEFQKQEGIDLSKDNMALQRLKDAAEKAKIELSGMSSTEIN QPFITMDANGPKHLTLTLTRAHFEKLASNLIERTKAPCQKALADAKLSASDIDDVLLVGGMSRMPAVQEV VKSIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQK KQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAA SGREQKIRIEASSGLKEDEIQRMINDAEKNKEEDKKRREASDVRNEADSMIFRAEKAISDYKENIPESLT KEIEERIEKVRSALKEDAPTEKIKEASDELSRHMQKIGEAMQSQSASAAANAQDGPNINTEDLKKHSFST KPPTGNSSSSANNENIEEADVEIVDKPND Protective antigen In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus [Ref1054:Héchard et al., 2002]. dnaX Chlamydophila abortus VO_0011056 62148024 CDD:180523 EnsemblGenomes-Gn:CAB327 EnsemblGenomes-Tr:CAH63776 GOA:Q5L6F0 InterPro:IPR003593 InterPro:IPR008921 InterPro:IPR012763 InterPro:IPR027417 UniProtKB/TrEMBL:Q5L6F0 218497 ? DNA polymerase III subunit gamma/tau 6.44 47941.3 526 DNA polymerase III subunits gamma and tau; Validated >CAH63776.1 DNA polymerase III subunit gamma/tau [Chlamydia abortus S26/3] MTSATYQVSSRKYRPQTFAEMLGQDAVVTVLKNALQFQRVAHAYLFSGIRGTGKTTLARIFAKALNCKEL TPEHEPCNQCCVCKEISSGTSLDVIEIDGASHRGIEDIRQINETVLFTPAKSQYKIYIIDEVHMLTKEAF NSLLKTLEEPPSHVKFFLATTENYKIPSTILSRCQKMHLKRIPETMIVDKLASISQAGGIETSREALLPI ARAAQGSLRDAESLYDYVIGLFPTSLSPELVADALGLLSQDTLATLSECIRTQKYAEALLPVTTAINSGV APITFLHDLTVFYRDVLLNKDQGNSPLSAIAMHYSSECLLEIIDFLGEAAKHLQQTIFEKTFLETVIIHL IRICQRPSLETLFSQLKTSTFDTVRNVPQQQEPSKPSIQPEKHYQDQSFLTSPSPTPKVQHQKEASPSLV GSATIDTLLQFAVVEFSGILTKE Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. [Ref1052:Stemke-Hale et al., 2005]. gatA Chlamydophila abortus VO_0010879 62184918 CDD:234572 218497 ? aspartyl/glutamyl-tRNA amidotransferase subunit A 6.09 50155.89 593 aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed; PRK00012 >YP_219703.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Chlamydophila abortus S26/3] MYQKSALELRNAVVSGESSATAIAKYFYNRIKTEDNQIGAFLSLCEERAYEKAAIIDAKVARGEPLGKLA GVPIGIKDNIHIRGLRTTCASKMLENYIAPFDATVVERIEAEDGVILGKLNMDEFAMGSTTQYSAFHPTK NPWGLSCVPGGSSGGSAAAVSARFCPIALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYGLVAFGSSLDQ IGPLTTVVEDVALAMDVFAGKDDRDATSQKFFTGSFQEALSLDVPSLIGVPMGFLDGLRDDVKENFFASL SILERQGSRIVEVDLNILDHAVSVYYIVASAEAATNLARFDGIRYGYRSPEAHSIEDIYTISRVQGFGKE VMRRILLGNYVLSTERQNVYYKKGSAIRAKIIQAFQKAYEKCDVIAMPVCSCPAFADGEILDPTSLYLQD IYTVAMNLAYLPAIAVPSGFSREGLPLGFQVIGQKGKDQQVCQVGYSFQEHSGIKNLYPKGCNKLVDGEV K Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance [Ref1052:Stemke-Hale et al., 2005]. Note: Part of CP #3 also belongs to gatB gatB Chlamydophila abortus VO_0010880 62147986 CDD:235489 EnsemblGenomes-Gn:CAB287 EnsemblGenomes-Tr:CAH63737 GOA:Q5L6I8 InterPro:IPR003789 InterPro:IPR004413 InterPro:IPR006075 InterPro:IPR017958 InterPro:IPR017959 InterPro:IPR018027 218497 ? aspartyl/glutamyl-tRNA amidotransferase subunit B 5.67 51934.12 583 aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; PRK05477 >CAH63737.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Chlamydia abortus S26/3] MSDVYADWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAVLFGCA VEGEVALLSRFDRKSYFYPDSPRNFQITQFEHPIVRGGHIKAIVHGEERHFELAQAHIEDDAGMLKHFGE FAGVDYNRAGVPLIEIVSKPCMFCADDAVAYATALVSLLDYIGISDCNMEEGSVRFDVNISVRPKGSEEL RNKVEIKNMNSFAFMAQALEAERCRQIDAYLDNPNADPKTVIPGATYRWDPEKKKTVLMRLKERAEDYKY FIEPDLPVLQLTEAYIDEIRHTLPELPFNKYQRYLHEYALAEDIAAILISDKHSAHFFELAAQECKNYRA LSNWLTVEFAGRCKLKGKNLAFSGILPSSVAQLVNFIDQGVITGKIAKDIADMMMESPEKSPETILKENP EMLPMTDESALVAIISEVITANPQSVVDYKSGKTKALGFLVGQIMKRTQGKAPPNRVNELLLVELSK Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance [Ref1052:Stemke-Hale et al., 2005]. Note: Part of CP #3 also belongs to gatA gatC Chlamydophila abortus VO_0011057 62184917 CDD:178810 218497 ? aspartyl/glutamyl-tRNA amidotransferase subunit C 4.07 10718.23 196 aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed; PRK00034 >YP_219702.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlamydophila abortus S26/3] MTQPYVTREDIILLAKSSALELSEEFIQEYESSLNEVIKTMAASIAMDVTDVVIEVGLSHVISPEDLRED IVASSFSREEFLTNVPESLGGLVKVPTVIK Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance [Ref1052:Stemke-Hale et al., 2005]. Ighv1-9 Mus musculus 668478 AC073561 10090 12 114583568 114583861 immunoglobulin heavy variable V1-9 Also known as Igg2a; Gm16697 >gi|372099098:114583568-114583861 Mus musculus strain C57BL/6J chromosome 12, GRCm38 C57BL/6J GTCTTGCACAGTAATAGATGGCAGAGTCCTCAGTTGTCAGGCTGCTGAGTTGCATGTAGGCTGTGTTGGA GGATGTATCTGCAGTGAATGTGGCCTTGCCCTTGAACTTCTCATTGTAGTTAGTACTACCACTTCCAGGT AAAATCTCTCCAATCCACTCAAGGCCATGTCCAGGCCTCTGCTTTACCCACTCTATCCAGTAGCCAGTGA ATGTGTAGCCAGTAGCCTTGCAGGAAAGCTTCACTGAGGCCCCAGGCTTCATCAGCTCAGCTCCAGACTG CTGCAGCTGAACCT Vaximmutor omlA Chlamydophila abortus VO_0011060 62184824 CDD:308876 218497 ? outer membrane lipoprotein 8.12 9011.35 160 Chlamydia cysteine-rich outer membrane protein 3; pfam03503 >YP_219609.1 outer membrane lipoprotein [Chlamydophila abortus S26/3] MKKAVLLATVFCGALGLTSCCRIVDCCFEDPCAPKPCNPCGNKKDKGCSPCGTYTPSCSKPCGSECNSGV QGPQAKGCTSLDGRCKQ Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) [Ref1052:Stemke-Hale et al., 2005]. omp1 Chlamydophila abortus VO_0010881 40601 CDD:279628 GOA:P16567 InterPro:IPR000604 UniProtKB/Swiss-Prot:P16567 83555 ? major outer membrane protein 7.65 40147.34 457 submitted as Chlamydia psittaci; enzootic abortion >CAA36152.1 major outer membrane protein [Chlamydia abortus] MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCSTWCDAISIRAGYYGDYVF DRVLKVDVNKTITGMGAVPTGTAAANYKTPTDRPNIAYGKHLQDAEWFTNAAFLALNIWDRFDIFCTLGA SNGYFKASSAAFNLVGLIGVKGSSIAADQLPNVGITQGIVEFYTDTTFSWSVGARGALWECGCATLGAEF QYAQSNPKIEMLNVVSSPAQFVVHKPRGYKGTAFPLPLTAGTDQATDTKSATIKYHEWQVGLALSYRLNM LVPYISVNWSRATFDADAIRIAQPKLAAAVLNLTTWNPTLLGEATALDTSNKFADFLQIASIQINKMKSR KACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF Protective antigen The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus [Ref1053:Héchard et al., 2003]. pomp90A Chlamydophila abortus VO_0011058 187438939 CDD:273587 83555 ? polymorphic outer membrane protein 90A 4.63 35956.31 446 Chlamydial polymorphic outer membrane protein repeat; TIGR01376 >ACD10929.1 polymorphic outer membrane protein 90A, partial [Chlamydia abortus] MSNSLSFANDAQTALTPSDSYNGNVTSEEFQVKETSSGTTYTCEGNVCISFAGKDSGLKKSCFSATDNLT FLGNGYTLCFDNITTTASNPGAINVQGQGKTLGISGFSLFSCAYCPPGTTGYGAIQTKGNTTLKDNSSLV FHKNCSTAEGGAIQCKGSSDAELKIENNQNLVFSENSSTSKGGAIYADKLTIVSGGPTLFSNNSVSNGSS PKGGAISIKDSSGECSLTADLGDITFDGNKIIKTSGGSSTVTRNSIDLGTGKFTKLRAKDGFGIFFYDPI TGGGSDELNINKKETVDYTGKIVFSGEKLSDEEKARAENLASTFNQPITLSAGSLVLKDGVSVTAKQVTQ EAGSTVVMD Protective antigen Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). [Ref1052:Stemke-Hale et al., 2005]. Bandholtz et al., 2002 journal Bandholtz L, Kreuger MR, Svanholm C, Wigzell H, Rottenberg ME 2002 130 3 393-403 Clinical and experimental immunology Chalmers et al., 1997 journal Chalmers WS, Simpson J, Lee SJ, Baxendale W 1997 141 3 63-67 The Veterinary record Héchard et al., 2002 journal Héchard C, Grépinet O, Rodolakis A 2002 33 3 313-326 Veterinary research Héchard et al., 2003 journal Héchard C, Grépinet O, Rodolakis A 2003 52 Pt 1 35-40 Journal of medical microbiology Héchard et al., 2004 journal Héchard C, Grépinet O, Rodolakis A 2004 53 Pt 9 861-868 Journal of medical microbiology Stemke-Hale et al., 2005 journal Stemke-Hale K, Kaltenboeck B, DeGraves FJ, Sykes KF, Huang J, Bu CH, Johnston SA 2005 23 23 3016-3025 Vaccine Wiki: Chlamydophila abortus website http://en.wikipedia.org/wiki/Chlamydophila_abortus