Marek's disease virus 10390 Marek's disease The causative agent of Marek’s disease. Gallid HV2 (Marek's disease virus)is highly contagious in chickens and induces T cell lymphomas in susceptible birds, causing annual losses to the worldwide poultry industry estimated at US$100 billion (Morrow and Fehler 2004). In the 100 years since Marek’s disease was first described, the disease has substantially increased in severity of symptoms. The first vaccines for gallid HV2 were developed in the late 1960’s and early 1970’s; but new, more virulent strains of the virus have emerged that are resistant to vaccine-induced immune responses (Nair 2005). The virulence of gallid HV2 is expected to be a polygenic trait, with allelic variants at a number of loci playing a role (Shamblin et al. 2004). Thus, homologous recombination is expected to play an important role in the evolution of virulence, because it can bring together new mutations that originally evolved against different genetic backgrounds. DNA replication in alphaherpesviruses is recombination-dependent, providing a mechanism for homologous recombination between genetically distinct viruses infecting the same cell (Thiry et al. 2004). Sequence analysis has provided evidence of past homologous recombination events in several herpesviruses, including alphaherpesviruses (Bowden et al. 2004; Norberg et al. 2004; Peters et al. 2006) (Hughes and Rivailler, 2007). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Bursal Disease-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 1A88.R0) Merial, Inc., Biomune Company VO_0002197 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.42) Merial, Inc. VO_0002043 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.4A) Merial, Inc. VO_0002047 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1A82.50) Wyeth VO_0002196 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0) Biomune Company VO_0002040 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R1) Biomune Company VO_0002041 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.43) Merial, Inc. VO_0002044 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.44) Merial, Inc. VO_0002045 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.45) Merial, Inc. VO_0002046 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1B82.50) Wyeth VO_0002200 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R1) Biomune Company VO_0002198 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R2) Merial, Inc. VO_0002199 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.40) Merial, Inc. VO_0002051 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.43) Merial, Inc. VO_0002053 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.42) Merial, Inc. VO_0002052 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.44) Merial, Inc. VO_0002054 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant Strain, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.52) Intervet Inc. VO_0002050 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotype 3, Live Virus Vaccine (USDA: 1282.50) Intervet Inc. VO_0002042 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: ) Intervet Inc. VO_0002031 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.50) Intervet Inc. VO_0002048 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.51) Intervet Inc. VO_0002049 Live vaccine Licensed USA Fowl Laryngotracheitis-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16J1.R1) Intervet Inc. VO_0002141 Live vaccine Licensed USA Fowl Laryngotracheitis-Marek's Disease Serotypes 2 & 3, Modified Live & Live Marek's Disease Vector Vaccine (USDA: 16J1.R2) Intervet Inc. VO_0002142 Live vaccine Licensed USA Fowl Pox-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 15E2.00) Merial, Inc. VO_0002140 Live vaccine Licensed USA Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.00) Intervet Inc., Merial, Inc., Biomune Company VO_0001683 Live vaccine Licensed USA Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.04) Pfizer, Inc. VO_0001684 Live vaccine Licensed USA Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.09) Intervet Inc. VO_0001685 Live vaccine Licensed USA Marek's Disease Serotype 2, Live Virus Vaccine (USDA: 1631.00) Intervet Inc., Merial, Inc., Biomune Company VO_0001686 Live vaccine Licensed USA Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.00) Wyeth, Intervet Inc., Merial, Inc. VO_0001687 Live vaccine Licensed USA Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.01) Wyeth, Merial, Inc. VO_0001688 Live vaccine Licensed USA Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.06) Intervet Inc. VO_0001689 Live vaccine Licensed USA Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 16L1.06) Biomune Company VO_0001690 Live vaccine Licensed USA Marek's Disease Serotypes 1 & 2 & 3, Live Virus Vaccine (USDA: 16L1.01) Intervet Inc., Biomune Company VO_0001691 Live vaccine Licensed USA Marek's Disease Serotypes 1 & 3, Live Herpesvirus Chimera Vaccine (USDA: 1631.R0) Intervet Inc. VO_0001692 Live vaccine Licensed USA Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16G1.02) Wyeth VO_0001693 Live vaccine Licensed USA Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16L1.02) Intervet Inc., Merial, Inc., Biomune Company VO_0001694 Live vaccine Licensed USA Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16L1.08) Intervet Inc. VO_0001695 Live vaccine Licensed USA Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.00) Intervet Inc., Merial, Inc. VO_0001696 Live vaccine Licensed USA Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.01) Intervet Inc., Merial, Inc. VO_0001697 Live vaccine Licensed USA Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.02) Intervet Inc. VO_0001698 Live vaccine Licensed USA Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.05) Intervet Inc. VO_0001699 Live vaccine Licensed USA Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 16G1.00) Wyeth VO_0001700 Live vaccine Licensed USA Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 16L1.07) Biomune Company VO_0001701 Live vaccine Licensed USA Marek's Disease Virus Vaccine rFPV/gB1 VO_0011393 Recombinant vector vaccine Research Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV) coding for glycoprotein B1 (gB1) [Ref1174:Lee et al., 2003]. wing web (ww) and intra-abdominal (i.a.) routes wing web (ww) and intra-abdominal (i.a.) routes Recombinant vector construction Groups of 17 chickens were vaccinated at 1 day of age with variable dosage from 10^1 to 10^6 plaque-forming units (PFU) of rFPV vaccines by both the wing web (ww) and intra-abdominal (i.a.) routes in trial 1. Monovalent vaccines of either SB-1 or HVT were administered to chickens by the i.a. route at a dose of 2000 PFU. For rFPV + MDV vaccines, each component was administered by a separate inoculation. The ab+ chickens were used in all the experiments (Lee et al., 2003). rFPV/gB1 expressing MDV040 conferred 42% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates (Lee et al., 2003). At 6 days posthatch, groups of vaccinated and unvaccinated chickens were challenged by i.a. inoculation of 500 PFU of strain Md5. Mortality during the course of the experiment was recorded, and chickens were examined for gross MD lesions (Lee et al., 2003). Marek's Disease Virus Vaccine rFPV/gI VO_0011392 Recombinant vector vaccine Research Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV) coding for glycoprotein I (gI). wing web (ww) and intra-abdominal (i.a.) routes wing web (ww) and intra-abdominal (i.a.) routes Recombinant vector construction Groups of 17 chickens were vaccinated at 1 day of age with variable dosage from 10^1 to 10^6 plaque-forming units (PFU) of rFPV vaccines by both the wing web (ww) and intra-abdominal (i.a.) routes in trial 1. Monovalent vaccines of either SB-1 or HVT were administered to chickens by the i.a. route at a dose of 2000 PFU. For rFPV + MDV vaccines, each component was administered by a separate inoculation. The ab+ chickens were used in all the experiments (Lee et al., 2003). rFPV/gI expressing MDV095 conferred 43% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates (Lee et al., 2003). At 6 days posthatch, groups of vaccinated and unvaccinated chickens were challenged by i.a. inoculation of 500 PFU of strain Md5. Mortality during the course of the experiment was recorded, and chickens were examined for gross MD lesions (Lee et al., 2003). Marek's Disease-Newcastle Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16N1.R0) Intervet Inc., Biomune Company VO_0002143 Live vaccine Licensed USA Marek's Disease-Newcastle Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 16N1.R2) Biomune Company VO_0002145 Live vaccine Licensed USA Marek's Disease-Newcastle Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 16N1.R1) Biomune Company VO_0002144 Live vaccine Licensed USA Marek's Disease-Newcastle Disease Serotypes 2 & 3, Live Virus & Live Marek's Disease Vector Vaccine (USDA: 17H1.R1) Biomune Company VO_0002182 Live vaccine Licensed USA Marek's Disease-Newcastle Disease Serotypes 2 & 3, Live Virus & Live Marek's Disease Vector Vaccine (USDA: 17H1.R2) Intervet Inc. VO_0002183 Live vaccine Licensed USA Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live & Modified Live Virus Vaccine (USDA: 16T1.00) Merial, Inc. VO_0002146 Live vaccine Licensed USA Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live Virus Vaccine (USDA: 16T1.03) Intervet Inc. VO_0002147 Live vaccine Licensed USA Vaxxitek HVT+IBD Vaxxitek HVT+IBD Merial VO_0011473 Live, attenuated vaccine Licensed Intramuscular injection (i.m.) Live recombinant chimera virus expressing VP2 gene of IBD on HTV virus(Darteil et al., 1995) Intramuscular injection (i.m.) MDV040 Gallid alphaherpesvirus 2 VO_0011164 4811501 125745079 MD5V_040 AF147806 YP_001033956 10390 61024 63651 - envelope glycoprotein B 8.4 92434.87 865 glycoprotein BALF4; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA; BALF4 is a transmembrane glycoprotein found in the lipid envelope of several herpesviruses >NC_002229.3:61024-63651 Gallid herpesvirus 2, complete genome TTTTATTCAGTTCAAATATAATAGTGCCCACTTACACAGCATCATCTTCTGAGTCTGAATATGTAGTAGG TAACTTATCATATTTAGGGTTACTATTTTTAATCCTCATTTTTGCCAGGTGGTCCGATAGAACGGCGGTA GTGCCTCGCCTCTTTCTCCGCAGTTTTTTCTCGTGGCGTTCTTCCGCGGAGACTAACGCCATATATTTTA TCATTTCTCTAGCTTCTTCTAATTTTCTTTCATCAATAGATGTTCGTTCCAAATCATCTGATTCCTCGCC ATGCAACTCACGCGTTGCCTGTGCCTTAAGCACTTCTGTTGTCATAGGATAAAGGGCTTTCATTGGATTG CTTTTAAGCTTGTTTACATAACGATATGCTAAAAATGCAGCCACGAGTCCTGCTATAATGATTAAACCGA TTGCCAAAGCCCCAAAGGGATTTGACATGAAAGCAGAGACACCAGATATGGTAGATACGATTGCACCGGC AGCCCCTACTACAACTTTGCCTATAGCTTGCCCTACCTGACCCATACCGTTAAACAATTCGGCCAAACCG TTCATAAACGCGTAATTTGTATCCACTTCTATTACTTTGTTTATGTCATAAAATTTAAGTTCATGTAGTT GATTGCGGCGAGCTACTTCTGCATAATCCAATACACCAACATCACGCAACTCTTCTTTTGTGTAAACGGA TAAAGGCAAAATTTCCCGATCTTCTAGCAGGGTTAGATTAAGCTCGACAAATGTGCTAGCAATCTGTATA TCGGCAGCGTCTACCATCTTAACAAAATTATAGTTTTCAAATAAAGCATAACCGGATCCAAACAGAAAAT ATCTACGATGATTAGCCGAGCATGGCTCTACAGCCTCTAGCGTTGGAAGCAACTCGTTGTTTTCACCGAG TTGTCCCTGTATGTTTCCTTGGTTTTCTCCATATGAAAATAGAACCAATGGTCGGCTATAACATGTATTA GTGGATGTGATAACTCGCATAGAATTTTGCAAAGTGACGGATTCCGCATCTATAGCAGTGCAGCTCGATA CAGCAGCGACATCCCCCAACATCTTTGCAGCCACTCTCCTTCCTAATGTTGCACTCGCTGTAGCGCTAGG ATTAATCTTTATCCCTTCGTGCCATAAAACAAGTTCTCTATTCTGCAATTCGCACCAAGCTGTGGCAATC CTACTAAACATATCATTAATATGGGTTTGTATATGATCATAAAGAAATTGGAGCATGGCGAATTGAACAG ACGATGTCGATTTAATAGCTGTGGTGTCGTCTAATGTTATTTTTCTATTTGGTGCATTTCGAATATCTCG CCGCAATCGTGACAATGAGGTAGCATTTTTCTTATAAATTGCATGCTTATTGTTTACCAGGTCGAGCATC TCATCGGTCCTGTTGTCTCTCATCAATTCTCTGAGGTACATATGAGCCAGGGATTTGGATAGAACAGGCT GATATGCTACAATAAATCCCCCGAGAGCCAAGAAATATTGTACATGTCCAACCTTGACGTGACTGTCATT ATATTTTGTCCTAAATATCTGCTCGATTGCTGCTTCTGCCTCGCGTTTAATACATTGTCCTAATATGATG CGATTTGGATCAAACTCAGTCGTATTACTGATAAACGTTGCCGAAAGTTCACGGGCCATAAATCTGTATC TCCCATTAACTGTTGCACGCAACATTTCAGTCACCTCTTTCCACTTAGTCATTGAACATACACGAGTAGT TTTTGGAGCCCAGTCCCACCCAACTGTGAAGTGTGATGTGATGAGAAAGTTACGCTTGACTGGAAGGCTT GCTTTTCGACGCTTGTCCAAATCCATTGAAAAATAGCTATCTAGTTGTTTGAAATTATCCTGGGGATATC CCATGGGTTCTGCGGCAGCCTCTGGTGGGGATAGACCATAAAATGGAGATATGTTCGCGATGTCGCCATT GGCCATTGCAAAATATGAATACGGAAACACAGAGCGGGCATCCATTTCCTCTACTATACAATTGACGGAG GTTCCCGTTCGATATATCCATGGTGATCCCCACACGGTATACGTCTCATTAGTCGTGTGCCATGCCCTAG ATTCGGGCGTGTTGAATTTTGATGGTTTTAGAAGTACTTGTTTTTCTCCCGCATCCCTGTCAAACGCTTC AACATATACATTGTTTCTAAGGTATCTTGCTTTAGATGAGCATCTTCCTTTGCCGTCGATTAGATCCGTG ATCTCTTCAATGGAAACGGGCGTCCTATCTGTATATCGATTAGTGATCTGTCTATATGTCGTCCCCGTCC ATGTCGTCGTCTGAATGATATTTTTATAATAAAGCGTCACTTTAAATTTATATGGACTGATATTCTCTTT AAATAATATCGCGATTCCTTCACCCCATTCGGTGGCTTTTCTAGGTTCGGGACATTTTCGCGGCGGTTCT AGACGGATCACGGTTGAACCCACTGGTGGGGGACAAAGATAAAACGTAGACTCTTCCTCAGACAACTGGA CGCTCGAAACAACTTCTCTTGATGTCACATTTTGGGTACTCGGAGATGAGTTCGTACCATATAGAATAAC TATAAGGAAAAAAATGCAATTCCGCCTAAAATAGTGCA >YP_001033956.1 envelope glycoprotein B [Gallid alphaherpesvirus 2] MHYFRRNCIFFLIVILYGTNSSPSTQNVTSREVVSSVQLSEEESTFYLCPPPVGSTVIRLEPPRKCPEPR KATEWGEGIAILFKENISPYKFKVTLYYKNIIQTTTWTGTTYRQITNRYTDRTPVSIEEITDLIDGKGRC SSKARYLRNNVYVEAFDRDAGEKQVLLKPSKFNTPESRAWHTTNETYTVWGSPWIYRTGTSVNCIVEEMD ARSVFPYSYFAMANGDIANISPFYGLSPPEAAAEPMGYPQDNFKQLDSYFSMDLDKRRKASLPVKRNFLI TSHFTVGWDWAPKTTRVCSMTKWKEVTEMLRATVNGRYRFMARELSATFISNTTEFDPNRIILGQCIKRE AEAAIEQIFRTKYNDSHVKVGHVQYFLALGGFIVAYQPVLSKSLAHMYLRELMRDNRTDEMLDLVNNKHA IYKKNATSLSRLRRDIRNAPNRKITLDDTTAIKSTSSVQFAMLQFLYDHIQTHINDMFSRIATAWCELQN RELVLWHEGIKINPSATASATLGRRVAAKMLGDVAAVSSCTAIDAESVTLQNSMRVITSTNTCYSRPLVL FSYGENQGNIQGQLGENNELLPTLEAVEPCSANHRRYFLFGSGYALFENYNFVKMVDAADIQIASTFVEL NLTLLEDREILPLSVYTKEELRDVGVLDYAEVARRNQLHELKFYDINKVIEVDTNYAFMNGLAELFNGMG QVGQAIGKVVVGAAGAIVSTISGVSAFMSNPFGALAIGLIIIAGLVAAFLAYRYVNKLKSNPMKALYPMT TEVLKAQATRELHGEESDDLERTSIDERKLEEAREMIKYMALVSAEERHEKKLRRKRRGTTAVLSDHLAK MRIKNSNPKYDKLPTTYSDSEDDAV Protective antigen Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV, Gallid herpesvirus 2). rFPV/gB1 expressing MDV040 conferred 42% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates [Ref1174:Lee et al., 2003]. MDV095 Gallid alphaherpesvirus 2 VO_0011165 4811454 125745128 MD5V_095 AF243438 YP_001034012 10390 161182 164094 + envelope glycoprotein I 6.7 37988.3 355 envelope glycoprotein I; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; envelope glycoprotein E and glycoprotein I form a heterodimer that play important roles in virus cell-to-cell spread >NC_002229.3:161182-164094 Gallid herpesvirus 2, complete genome GATGTATCTACTACAATTATTATTTTGGATCCGCCTCTTTCGAGGCATCTGGTCTATAGTTTATACTGGA ACATCTGTTACGTTATCAACGGACCAATCTGCTCTTGTTGCGTTCTGCGGATTAGATAAAATGGTGAATG TACGCGGCCAACTTTTATTCCTGGGCGACCAGACTCGGACCAGTTCTTATACAGGAACGACGGAAATCTT GAAATGGGATGAAGAATATAAATGCTATTCCGTTCTACATGCGACATCATATATGGATTGTCCTGCTATA GACGCCACGGTATTCAGAGGCTGTAGAGACGCTGTGGTATATGCTCAACCTCATGATAGAGTACAACCTT TTCCCGAAAAGGGAACATTGTTGAGAATTGTCGAACCCAGAGTATCAGATACAGGCAGCTATTACATACG TGTAGCTCTCGCTGGAAGAAATATGAGCGATATATTTAGAATGGCTGTTATTATAAGGAGTAGCAAATCT TGGGCCTGTAATCACTCTGCTAGTTCATTTCAGGCCCATAAATGTATTCGCTATGTCGACCGTATGGCCT TTGAAAATTATCTGATTGGACATGTAGGCAATTTGCTGGACAGTGACTCGGAATTGCATGCAATTTATAA TATTACTCCCCAATCCATTTCCACAGATATTAATATTATAACGACTCCATTTTACGATAATTCGGGAACA ATTTATTCACCTACGGTTTTTAATTTGTTTAATAACAATTCCCATGTCGATGCAATGAATTCGACTGGTA TGTGGAATACCGTTTTAAAATATACCCTTCCAAGGCTTATTTACTTTTCTACGATGATTGTACTATGTAT AATAGCATTGGCAATTTATTTGGTCTGTGAAAGGTGCCGCTCTCCCCATCGTAGGATATACATCGGTGAA CCAAGATCTGATGAGGCCCCACTCATCACTTCTGCAGTTAACGAATCATTTCAATATGATTATAATGTAA AGGAAACTCCTTCAGATGTTATTGAAAAGGAGTTGATGGAAAAACTGAAGAAGAAAGTCGAATTGTTGGA AAGAGAAGAATGTGTATAGGTTTGAGAAACTATTATAGGTAGGTGGTACCTGTTAGCTTAGTATAAGGGG AGGAGCCGTTTCTTGTTTTAAAGACACGAACACAAGGCAGTAAGTTTTATATGTGAATTTTGTGCATGTC TGCGAGTCAGCGTCATAATGTGTGTTTTCCAAATCCTGATAATAGTGACGACGATCAAAGTAGCTGGAAC GGCCAACATAAATCATATAGACGTTCCTGCAGGACATTCTGCTACAACGACGATCCCGCGATATCCACCA GTTGTCGATGGGACCCTTTACACCGAGACGTGGACATGGATTCCCAATCACTGCAACGAAACGGCAACAG GCTATGTATGTCTGGAAAGTGCTCACTGTTTTACCGATTTGATATTAGGAGTATCCTGCATGAGGTATGC GGATGAAATCGTCTTACGAACTGATAAATTTATTGTCGATGCGGGATCCATTAAACAAATAGAATCGCTA AGTCTGAATGGAGTTCCGAATATATTCCTATCTACGAAAGCAAGTAACAAGTTGGAGATACTAAATGCTA GCCTACAAAATGCGGGTATCTACATTCGGTATTCTAGAAATGGGACGAGGACTGCAAAGCTGGATGTTGT TGTGGTTGGCGTTTTGGGTCAAGCAAGGGATCGCCTACCCCAAATGTCCAGTCCTATGATCTCATCCCAC GCCGATATCAAGTTGTCATTAAAAAACTTTAAAGCATTAGTATATCACGTGGGAGATACTATCAATGTCT CGACGGCGGTTATACTAGGACCTTCTCCGGAGATATTCACATTGGAATTTAGGGTGTTGTTCCTCCGTTA TAATCCAACGTGCAAGTTCGTCACGATTTATGAACCTTGTATATTTCACCCCAAAGAACCAGAGTGTATT ACTACTGCAGAACAATCGGTATGTCATTTCGCATCCAACATTGACATTCTGCAGATAGCCGCCGCACGTT CTGAAAATTGTAGCACAGGGTATCGTAGATGTATTTATGACACGGCTATCGATGAATCTGTGCAGGCCAG ATTAACATTCATAGAACCAGGAATTCCTTCCTTTAAAATGAAAGATGTCCAGGTAGACGATGCTGGATTG TATGTGGTTGTGGCTTTATACAATGGACGTCCAAGTGCATGGACTTACATTTATTTGTCAACGGTGGAAA CATATCTTAATGTATATGAAAACTACCACAAGCCGGGATTTGGGTATAAATCATTTCTACAGAACAGTAG TATCGTCGACGAAAATGAGGCTAGCGATTGGTCCAGCTCGTCCATTAAACGGAGAAATAATGGTACTATC ATTTATGATATTTTACTCACATCGCTATCAATTGGGGCGATTATTATCGTCATAGTAGGGGGTGTTTGTA TTGCCATATTAATTAGGCGTAGGAGACGACGTCGCACGAGGGGGTTATTCGATGAATATCCCAAATATAT GACGCTACCAGGAAACGATCTGGGGGGCATGAATGTACCGTATGATAATACATGCTCTGGTAACCAAGTT GAATATTATCAAGAAAAGTCGGCTAAAATGAAAAGAATGGGTTCGGGTTATACCGCTTGGCTAAAAAATG ATATGCCGAAAATTAGGAAACGCTTAGATTTATACCACTGATATGTACATATTTAAACTTAATGGGATAT AGTATATGGACGTCTATATGACGAGAGTAAATAAACTGACACTGCAAATGAAGCTGATCTATATTGTGCT TTATATTGGGACAAACCACTCGCACAAGCTCATTCAACACATCCACTCTTGCTATTAAATTCCCCATTAT ATAACAATACTGACATAACACTCATATTAAGGGGAGAAAATAA >YP_001034012.1 envelope glycoprotein I [Gallid alphaherpesvirus 2] MYLLQLLFWIRLFRGIWSIVYTGTSVTLSTDQSALVAFCGLDKMVNVRGQLLFLGDQTRTSSYTGTTEIL KWDEEYKCYSVLHATSYMDCPAIDATVFRGCRDAVVYAQPHDRVQPFPEKGTLLRIVEPRVSDTGSYYIR VALAGRNMSDIFRMAVIIRSSKSWACNHSASSFQAHKCIRYVDRMAFENYLIGHVGNLLDSDSELHAIYN ITPQSISTDINIITTPFYDNSGTIYSPTVFNLFNNNSHVDAMNSTGMWNTVLKYTLPRLIYFSTMIVLCI IALAIYLVCERCRSPHRRIYIGEPRSDEAPLITSAVNESFQYDYNVKETPSDVIEKELMEKLKKKVELLE REECV Protective antigen Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV, Gallid herpesvirus 2). rFPV/gI expressing MDV095 conferred 43% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates [Ref1174:Lee et al., 2003]. Darteil et al., 1995 journal Darteil R, Bublot M, Laplace E, Bouquet JF, Audonnet JC, Rivière M 1995 211 2 481-490 Virology Hughes and Rivailler, 2007 journal Hughes AL, Rivailler P 2007 130 1-2 28-33 Virus research Lee et al., 2003 journal Lee LE, Witter RL, Reddy SM, Wu P, Yanagida N, Yoshida S 2003 47 3 549-558 Avian diseases