Klebsiella pneumoniae 573 Pneumonia, Bloodstream infections, Abscess Klebsiella pneumoniae is a Gram-negative, non-motile, encapsulated, lactose-fermenting, facultative anaerobic, rod-shaped bacterium. It can cause different types of healthcare-associated infections, including pneumonia, bloodstream infections, abscesses, and meningitis. The genus Klebsiella was named after the German microbiologist Edwin Klebs (1834–1913). Klebsiella pneumoniae naturally occurs in the soil, and about 30% of strains can fix nitrogen in anaerobic conditions. It can also be found in the normal flora of the mouth, skin, and intestines. However, if aspirated, It can cause destructive changes to human and animal lungs, specifically to the alveoli resulting in bloody, brownish or yellow colored jelly-like sputum. Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 c-di-GMP [c- diguanylate] Subunit vaccine Research i.t. The c-di-GMP used in these studies was chemically synthesized and prepared (Karaolis et al., 2007) i.t. The c-di-GMP used in these studies was chemically synthesized and prepared (Karaolis et al., 2007) Capsular types Kl, K36, K44 and K Cross Subunit vaccine Research Intraperitoneal injection (i.p.) Capsular were extracted from culture filtrates of K. aerogenes Kl a, Kl b, Kl c,K36, K44 and K Cross. Intraperitoneal injection (i.p.) Capsular types Kl, K36, K44 and K Cross (Roe and Jones, 1984) CpG ODN (Two CpG motifs) Subunit vaccine Research i.t. Active and control CpG ODN were synthesized on a phosphodiester backbone by Oligos Etc. (Deng et al., 2004) i.t. Synthetic oligodeoxynucleotides (ODN) containing unmethylated CpG dinucleotide motifs (CpG ODN) (Deng et al., 2004) CPS2 (Capsule polysaccharide) Subunit vaccine Research Intramuscular injection (i.m.) TiterMax Gold CPS2 was extracted from K. pneumoniae NJST258_2 culture supernatant (Malachowa et al., 2019) Intramuscular injection (i.m.) ST258 capsule polysaccharide type 2(CPS2) (Malachowa et al., 2019) CRM197-1 (Synthetic hexasaccharide) Conjugate vaccine Research subcutaneous injection CFA/ Alum the convergent [3+3] synthesis of the hexasaccharide repeating unit from its capsular polysaccharide and related sequences (Seeberger et al., 2017) subcutaneous injection CRM197-1 (Synthetic hexasaccharide) (Seeberger et al., 2017) K. pneumoniae polysaccharide-tetanus toxoid conjugate vaccine Conjugate vaccine Research Intramuscular injection (i.m.) The polysaccharide (PS) derived from K. pneumoniae NCTC 5055 lipopolysaccharide (LPS) was covalently linked to tetanus toxoid by using carbodimide with adipic acid dihydrazide as a spacer molecule (Chhibber et al., 2005). Intramuscular injection (i.m.) The polysaccharide (PS) derived from K. pneumoniae NCTC 5055 lipopolysaccharide (LPS) (Chhibber et al., 2005) Klebesiella FuyA protein vaccine Subunit vaccine Research pET28a intranasal immunization Yersiniabactin receptor coding gene FyuA of Klebsiella pneumoniae ,ATCC 43816 was amplified by colony PCR.The amplified gene was cloned into pET28a to produce N-terminally tagged hexahistidine fusions (Kumar et al., 2020) intranasal immunization FuyA (Yersinia bactin receptor FyuA) (Kumar et al., 2020) Recombinant protein preparation Yersiniabactin receptor coding gene FyuA of Klebsiella pneumoniae ATCC 43816 was amplified by colony PCR using the primers Forward 5′- AAGGATCCATGAAAATGACACGGCTTTAT-3'and Reverse5′- AACTCGAGTCAGAAGAAATCAATTCGCGT-3′ which were designed for the sequence with accession id NC_012731.1. The restriction sites BamHI and XhoI were present in forward and reverse primers respectively to generate sticky ends for cloning into the vector. The amplified gene was cloned into pET28a to produce N-terminally tagged hexahistidine fusions. The resulting constructs were verified by sequencing. The constructs without mutations were transformed into E.coli BL21 expression host. The expression was induced by the addition of 1 mM IPTG and further incubation at 37 °C with aeration for 4 h before harvesting the cells by centrifugation (Kumar et al., 2020). licensed Klebsiella pneumoniae infection human vaccine Generic Unknown Conjugate vaccine Licensed A generic representation of conjugate vaccines used to prevent Klebsiella pneumoniae infections, including pneumonia, bloodstream infections, and abscesses in humans. These vaccines typically combine bacterial polysaccharides with a protein carrier to enhance immunogenicity and protection. fyuA WP_142468275 CDD:273805 CDD:238657 570 ? siderophore yersiniabactin receptor FyuA 5.38 71520.78 768 TonB-dependent siderophore receptor; TIGR01783 >WP_142468275.1 MULTISPECIES: siderophore yersiniabactin receptor FyuA [Klebsiella] MKMTRFYPLVLGGFLLPAAAHSQTSQQDESTLVVTASKQSSHSASANNVSSTVISATELSDAGVTASDKL PRVLPGLNIENSGNMLFSTISLRGISSAQDFYNPAVTLYVDGVPQLSTNTIQALTDVQSVELLRGPQGTL YGKSAQGGIINIVTQQPDSTPRGYIEGGVSSRDSYRSKLNLSGPIQDGLLYGSVTLLRQVDDGEMINPST GSDDLGGTRASIGNVKLRLAPDDQPWEMGFSASRECTRATQDAYVAWNDLKSRTLSLSEGSPDPYLRRCT DSQTLSGKYATDDWVFNLIGAWQQQNYSRTFPSGSLIVNMPQRWNQDVQELRAATLGDTRTVDMVFGLYR QNTREKLNSAYDMPTMPYLSSTGYTTAETLAAYSDLTWHLTERFDIGGGVRFSHDKASTQYHGSMLGNPF GDQGKSNDDRVLGQLSAGYLLTDDWRVYTRVAQGYKPSGYNIVPTAGLDAKPFNAEKSINYEIGTRYETA DVTLQAATFYTHTKDMQLYSGPVGMQTLSNAGRANATGVELEAKWRFAQGWSWDINGNMIHSEFTNDSEL YHGNRVPFVPRYGAGSSVNGVIDTRYGALMPRLAVNLVGPHYFDGDNQLRQGTYATLDSSIGWQATERMN ISVYVDNLFDRRYRTYGYMNGSSAVAQVNMGRTVGINTRIDFF Protective antigen Ahmad et al., 2012 journal Ahmad TA, Haroun M, Hussein AA, El Ashry el SH, El-Sayed LH 2012 4 2 e33 Infectious disease reports Babu et al., 2017 journal Babu L, Uppalapati SR, Sripathy MH, Reddy PN 2017 8 1805 Frontiers in microbiology Chathley et al., 1996 journal Chathley UC, Sharma S, Chhibber S 1996 41 4 373-376 Folia microbiologica Chhibber and Bajaj, 1995 journal Chhibber S, Bajaj J 1995 13 2 179-184 Vaccine Chhibber et al., 2005 journal Chhibber S, Rani M, Vanashree Y 2005 43 1 40-45 Indian journal of experimental biology Clements et al., 2008 journal Clements A, Jenney AW, Farn JL, Brown LE, Deliyannis G, Hartland EL, Pearse MJ, Maloney MB, Wesselingh SL, Wijburg OL, Strugnell RA 2008 26 44 5649-5653 Vaccine Cooper and Rowley, 1982 journal Cooper JM, Rowley D 1982 60 6 629-641 The Australian journal of experimental biology and medical science Cryz et al., 1984 journal Cryz SJ Jr, Fürer E, Germanier R 1984 45 1 139-142 Infection and immunity Cryz et al., 1986 journal Cryz SJ Jr, Fürer E, Germanier R 1986 54 2 403-407 Infection and immunity Deng et al., 2004 journal Deng JC, Moore TA, Newstead MW, Zeng X, Krieg AM, Standiford TJ 2004 173 8 5148-5155 Journal of immunology (Baltimore, Md. : 1950) Feldman et al., 2019 journal Feldman MF, Mayer Bridwell AE, Scott NE, Vinogradov E, McKee SR, Chavez SM, Twentyman J, Stallings CL, Rosen DA, Harding CM 2019 116 37 18655-18663 Proceedings of the National Academy of Sciences of the United States of America Hegerle et al., 2018 journal Hegerle N, Choi M, Sinclair J, Amin MN, Ollivault-Shiflett M, Curtis B, Laufer RS, Shridhar S, Brammer J, Toapanta FR, Holder IA, Pasetti MF, Lees A, Tennant SM, Cross AS, Simon R 2018 13 9 e0203143 PloS one Hsieh et al., 2013 journal Hsieh PF, Liu JY, Pan YJ, Wu MC, Lin TL, Huang YT, Wang JT 2013 208 10 1580-1589 The Journal of infectious diseases Hussein et al., 2018 journal Hussein KE, Bahey-El-Din M, Sheweita SA 2018 119 12-18 Microbial pathogenesis Jain et al., 2015 journal Jain RR, Mehta MR, Bannalikar AR, Menon MD 2015 43 3 195-201 Biologicals : journal of the International Association of Biological Standardization Karaolis et al., 2007 journal Karaolis DK, Newstead MW, Zeng X, Hyodo M, Hayakawa Y, Bhan U, Liang H, Standiford TJ 2007 75 10 4942-4950 Infection and immunity Kuenen et al., 1994 journal Kuenen JD, van Dijke EE, Hol C, Bootsma HJ, Verhoef J, van Dijk H 1994 8 1 69-75 FEMS immunology and medical microbiology Kumar et al., 2020 journal Kumar A, Harjai K, Chhibber S 2020 144 104161 Microbial pathogenesis Kurupati et al., 2011 journal Kurupati P, Ramachandran NP, Poh CL 2011 18 1 82-88 Clinical and vaccine immunology : CVI Lavender et al., 2005 journal Lavender H, Jagnow JJ, Clegg S 2005 295 3 153-159 International journal of medical microbiology : IJMM Lee et al., 2015 journal Lee WH, Choi HI, Hong SW, Kim KS, Gho YS, Jeon SG 2015 47 9 e183 Experimental & molecular medicine Malachowa et al., 2019 journal Malachowa N, Kobayashi SD, Porter AR, Freedman B, Hanley PW, Lovaglio J, Saturday GA, Gardner DJ, Scott DP, Griffin A, Cordova K, Long D, Rosenke R, Sturdevant DE, Bruno D, Martens C, Kreiswirth BN, DeLeo FR 2019 10 6 mBio Nimier et al., 1999 journal Nimier K, Wolff F, Allouch PY, Guy-Grand D, Bloy C 1999 21 9 561-574 International journal of immunopharmacology Peng et al., 2021 journal Peng Z, Wu J, Wang K, Li X, Sun P, Zhang L, Huang J, Liu Y, Hua X, Yu Y, Pan C, Wang H, Zhu L 2021 8 14 e2100549 Advanced science (Weinheim, Baden-Wurttemberg, Germany) Rani et al., 1990 journal Rani M, Gupta RK, Chhibber S 1990 36 12 885-890 Canadian journal of microbiology Ravinder et al., 2020 journal Ravinder M, Liao KS, Cheng YY, Pawar S, Lin TL, Wang JT, Wu CY 2020 85 24 15964-15997 The Journal of organic chemistry Robert et al., 1981 journal Robert D, Michel S, Ivanoff B, Cozzone AJ, Fontanges R 1981 25 2 183-194 Microbiology and immunology Robert et al., 1982 journal Robert D, Bienvenu P, Lafont S, Jouanneteau B, Normier G, Dussourd D'Hinterland L, Fontanges R 1982 26 10 941-950 Microbiology and immunology Rodrigues et al., 2020 journal Rodrigues MX, Yang Y, de Souza Meira EB Jr, do Carmo Silva J, Bicalho RC 2020 38 29 4640-4648 Vaccine Roe and Jones, 1984 journal Roe EA, Jones RJ 1984 93 2 355-363 The Journal of hygiene Roe et al., 1989 journal Roe EA, Jones RJ, Saunders JR 1989 1 5 253-261 FEMS microbiology immunology Seeberger et al., 2017 journal Seeberger PH, Pereira CL, Khan N, Xiao G, Diago-Navarro E, Reppe K, Opitz B, Fries BC, Witzenrath M 2017 56 45 13973-13978 Angewandte Chemie (International ed. in English) Singh and Sharma, 2001 journal Singh BR, Sharma VD 2001 19 31 4505-4510 Vaccine Twentyman et al., 2020 journal Twentyman J, Morffy Smith C, Nims JS, Dahler AA, Rosen DA 2020 13 3 Disease models & mechanisms Wu et al., 2020 journal Wu G, Ji H, Guo X, Li Y, Ren T, Dong H, Liu J, Liu Y, Shi X, He B 2020 24 102148 Nanomedicine : nanotechnology, biology, and medicine