Mycobacterium bovis 1765 Tuberculosis Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Bacillus Calmette-Guérin Danish (BCG) VO_0004807 Live, attenuated vaccine Licensed subcutaneous injection subcutaneous injection Two groups of calves (n = 9/group) were vaccinated subcutaneously with a lyophilized BCG Danish vaccine containing either 0.5 (1 × 105 to 4 × 105 CFU) or 5 (1 × 106 to 4 × 106 CFU) human doses of BCG Danish, with an additional group of 10 calves serving as non vaccinated controls (Buddle et al., 2013). Vaccination of the calves with either 0.5 or 5 equivalent human doses of BCG Danish induced similar levels of protection against challenge with M. bovis, with both groups showing significant reductions in the pathological and microbiological parameters compared to those for the the control group (P < 0.05) (Buddle et al., 2013). Intratracheal challenge with 5 × 103 CFU of virulent M. bovis 15 weeks after vaccination (Buddle et al., 2013). licensed Tuberculosis human vaccine Generic Unknown VO_0001519 Live, attenuated vaccine Licensed A generic representation of vaccines used to prevent tuberculosis in humans, most notably the Bacillus Calmette-Guérin (BCG) vaccine. These vaccines contain live Mycobacterium bovis bacteria that have been attenuated to reduce virulence while stimulating protective immunity. M. bovis DNA vaccine pCI-Ag85B VO_0004806 DNA vaccine Research pCI [Ref3343:Teixeira et al., 2006] Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction This DNA vaccine encoded Ag85B (Teixeira et al., 2006). Ag85B DNA immunization induced a statistically significant reduction in M. bovis CFU numbers in spleens (log 0.56) compared to what was seen for mice that received the plasmid pCI alone (P < 0.05). However, there was no significant reduction in bacterial load in lungs of pCI-Ag85B-immunized mice compared to the pCI control group (Teixeira et al., 2006). 85-B Mycobacterium bovis strain 1173P2 44168 CDD:223700 GOA:A1KJU9 InterPro:IPR000801 UniProtKB/Swiss-Prot:A1KJU9 1765 ? protein or antigen 85-B 5.72 33433.87 410 S-formylglutathione hydrolase FrmB [Defense mechanisms]; COG0627 >CAA44268.1 protein or antigen 85-B [Mycobacterium tuberculosis variant bovis] MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG NNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETL LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGD AGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG Protective antigen Buddle et al., 2013 journal Buddle BM, Hewinson RG, Vordermeier HM, Wedlock DN 2013 20 10 1559-1562 Clinical and vaccine immunology : CVI Teixeira et al., 2006 journal Teixeira FM, Teixeira HC, Ferreira AP, Rodrigues MF, Azevedo V, Macedo GC, Oliveira SC 2006 13 8 930-935 Clinical and vaccine immunology : CVI