Hantavirus 11598 Rodents (primarily deer mice) carry hantaviruses that cause hantavirus pulmonary syndrome in human. Rodents shed the virus in their urine, droppings, and saliva. The virus is mainly transmitted to people when they breathe in air contaminated with the virus. Functional impairment of vascular endothelium is central to the pathogenesis of HPS, and a myocardial depressant may contribute significantly to the mortality of this disease. Hantaviruses can infect endothelial cells, macrophages and dendritic cells. The mechanism of inflammatory cell recruitment in the lungs of HPS patients may result from specific attraction and adherence of a selective population of inflammatory cells to an activated pulmonary microvascular endothelium (CDC Hantaviruses). Hantavirus Pulmonary Syndrome Klingström et al. reported that the strong Th2-type of immune response induced by Alum against rDOBV N did not induce protection in mice (Klingstrom et al., 2004). n the US, primarily deer mice, along with cotton rats and rice rats in the southeastern states and the white-footed mouse in the Northeast, carry hantaviruses that cause hantavirus pulmonary syndrome (CDC Hantaviruses). Hantaviruses are rodent-borne agents that cause hemorrhagic fever with renal syndrome or hantavirus pulmonary syndrome (HPS) in humans (de et al., 2002). Annually, around 150,000 cases of HFRS are reported worldwide, caused by Hantaan (HTNV) and Seoul (SEOV) hantaviruses in Asia and by Puumala (PUUV), Dobrava (DOBV), and Saaremaa (SAAV) hantaviruses in Europe (Klingstrom et al., 2004). Hantavirus was first identified in the United States in 1993. HPS is a deadly disease from rodents. Although rare, Although rare, the consequences of getting it are serious. Early symptoms include fatigue, fever and muscle aches. There may also be headaches, dizziness, chills, and abdominal problems, such as nausea, vomiting, diarrhea, and abdominal pain. The major HPS symptoms may not appear until the illness becomes life-threatening. Rodent control in and around the home remains the primary strategy for preventing hantavirus infection (CDC Hantaviruses). Hantaviruses can also cause human hemorrhagic fever with renal syndrome (HFRS) (Lednicky, 2003). Increased numbers of rodents in the household is the strongest risk factor for infection. Among documented U.S. cases of HPS, patients with potential occupational exposures have included grain farmers, an extension livestock specialist, field biologists, and agricultural, mill, construction, utility and feedlot workers (CDC Hantaviruses). Hantaviruses contain a three-segmented ssRNA-genome of negative polarity encoding four proteins: the nucleocapsid protein (N), the envelope proteins (G1 and G2), and the RNA dependent RNA polymerase (Klingstrom et al., 2004). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Andes virus vaccine using adenovirus viral vector expressing ANDV NP VO_0011561 Recombinant vector vaccine Research Nonreplicating adenovirus (Ad) vectors Intraperitoneal injection (i.p.) Intraperitoneal injection (i.p.) Andes virus nucleocapsid protein (ANDVsSgp1) Recombinant vector construction Nonreplicating (E1− E3−) Ad vectors expressing ANDV proteins were constructed using the AdMax HI-IQ system (Microbix, Toronto, Canada). The ANDV GN, GC, GPC, and N open reading frames were PCR amplified from plasmids containing the appropriate cDNAs derived from a Chilean ANDV isolate, strain 9717869. AdEmpty was constructed using plasmid pDC316(io) containing no ANDV sequences. These pDC316(io)-based ANDV plasmids were cotransfected with plasmid pBHGloxΔE1,3Cre, containing the remainder of the Ad5 genomic plasmid, into 293 IQ cells. Supernatants were collected after 6 to 8 days, and the presence of Ad vectors expressing the ANDV proteins (designated AdN, AdGN, AdGC, and AdGPC) was confirmed by immunoprecipitation. Ad vectors were plaque purified, propagated in large-scale infections in 293 IQ cells, and purified using standard CsCl gradient methods (Safronetz et al., 2009). Syrian gold Syrian golden hamsters (Mesocricetus auratus) (4- to 6-week-old males; Charles River, Pointe Claire, Canada) were group housed in microisolator units situated in the biosafety level 4 area of the National Microbiology Laboratory, Public Health Agency of Canada. Prior to vaccine experiments, the 50% lethal dose (LD50) for i.p. injections of ANDV in hamsters was established by inoculating anesthetized animals with 0.8 to 80,000 FFU (using 10-fold dilutions) of ANDV. Hamsters were monitored twice daily for clinical signs of illness according to an approved scoring sheet (ruffled fur, lethargy, inappetence, and labored breathing). For vaccination, hamsters were anesthetized with isoflurane, a preimmunization blood sample was collected, and the animals were immunized with the Ad vectors using 108 (293 cell) PFU of each vector diluted in 100 μl phosphate-buffered saline at two sites in the hind-leg musculature (Safronetz et al., 2009). Nonreplicating adenovirus (Ad) vectors that express Andes hantavirus (ANDV) nucleocapsid protein (AdN, ANDVsSgp1) or glycoproteins (AdG(N) and AdG(C)) were constructed . When administered once, all three Ad vectors, individually or in combination, elicited a robust immune response that protected Syrian hamsters from a lethal ANDV infection that mimics the pulmonary disease seen in humans. No vaccinated animal died, and there were no obvious clinical signs of disease (Safronetz et al., 2009). After 28 days, a second blood sample was collected and hamsters were challenged with ANDV by i.p. injection of 100 LD50s (equivalent to 154 FFU). Hamsters were examined twice daily for signs of illness. Survivors were monitored for 40 to 45 days and then anesthetized and exsanguinated via cardiac puncture (Safronetz et al., 2009). Chimaeric HBV core particles carrying Puumala virus nucleocapsid protein fragments VO_0004120 Recombinant vector vaccine Chimaeric hepatitis B virus (HBV) core particles were constructed to carry defined fragments of the Puumala virus nucleocapsid protein. Puumala is a European hantavirus (Ulrich et al., 1998). The Puumala virus nucleocapsid protein (Ulrich et al., 1998). DNA vaccine encoding ANDV glycoproteins VO_0004119 DNA vaccine pWRG/HTN-M(x), a customized plasmid built from pWRG7077 [Ref496:Custer et al., 2003] An expression plasmid, pWRG/AND-M, was constructed that contains the full-length M genome segment of Andes virus (ANDV), a South American hantavirus (Custer et al., 2003). Both the G1 and G2 glycoproteins are expressed (Custer et al., 2003). Recombinant protein preparation The Hantavirus G2 glycoprotein was expressed in the DNA vaccine (Custer et al., 2003). VO_0000286 Rhesus macaques vaccinated by gene gun with pWRG/AND-M developed remarkably high levels of neutralizing antibodies that not only neutralized ANDV (a South American hantavirus) but also cross-neutralized other HPS-associated hantaviruses, including Sin Nombre virus (Custer et al., 2003). Dobrava-Belgrade virus S nucleocapsid protein vaccine VO_0011512 Subunit vaccine Research Subcutaneous injection Freund's adjuvant Subcutaneous injection Dobrava-Belgrade virus S nucleocapsid protein Recombinant protein preparation His-tagged rDOBV N and recombinant mouse dihydrofolate reductase (rDHFR) was prepared. Freund’s complete adjuvant (FCA) or incomplete (FIA) adjuvant (Sigma, St. Louis, MO) or PBS. A total of 50 μg of recombinant protein was mixed with Alum and FCA/FIA, according to the manufacturers’ descriptions, or PBS, in a total volume of 200 μl per dosage (Klingstrom et al., 2004). C57/BL6 A total of 50 μg of recombinant protein was mixed with Alum and FCA/FIA, according to the manufacturers’ descriptions, or PBS, in a total volume of 200 μl per dosage. All immunizations and boosters were administered subcutaneously. rDOBV N or rDHFR in Alum, FCA or PBS were administered at day 0. At days 21 and 92, mice were boosted with rDOBV N or rDHFR in Alum, FIA or PBS (Klingstrom et al., 2004). Study compared the immunogenicity and protective efficacy of recombinant DOBV nucleocapsid protein (rDOBV N, S) given with Alum or Freund's as adjuvant, or PBS, in C57/BL6 mice. Mice receiving rDOBV N with Freund's adjuvant were protected from challenge (75% protected) (Klingstrom et al., 2004). At day 118, all mice were challenged with 10 mouse ID50 of DOBV and 21 days later, all mice were sacrificed. Serum, plasma, and EDTA-blood were drawn at the time points indicated below (Klingstrom et al., 2004). Significantly higher numbers of IL-4 producing cells were found in the groups given rDOBV N with Freund’s adjuvant as compared to rDOBV N with PBS. These reactions were found in peripheral blood mononuclear cells (PBMCs) 113 days after vaccination (Klingstrom et al., 2004). Significantly higher levels of IL-2 producing cells were found in the group given rDOBV N with Alum as compared to the rDHFR vaccinated groups and PBS vaccinated groups. These results were found in mice peripheral blood mononuclear cells (PBMCs) 113 days after vaccination (Klingstrom et al., 2004). Hantavirus DNA vaccine pWRG/HTN-M VO_0004576 DNA vaccine Research pWRG7077 [Ref2704:Hooper et al., 2001] Gene gun Gene gun DNA vaccine construction VO_0003057 All of the hamsters that were vaccinated with pWRG/HTN-M were protected against infection as defined by an absence of a postchallenge N-specific antibody response. In addition, the pre- and postchallenge PRNT titers differed by ≤4-fold. In contrast, all of the negative control hamsters, whether they were vaccinated with pWRG7077 or remained unvaccinated, were infected, as evidenced by the development of N-specific antibodies and neutralizing antibodies postchallenge (Hooper et al., 2001). licensed Hantavirus pulmonary syndrome human vaccine Generic Unknown VO_0012167 Inactivated or "killed" vaccine Licensed A generic representation of vaccines utilized to prevent Hantavirus Pulmonary Syndrome in humans, typically employing inactivated hantavirus particles to elicit protective immune responses without causing disease. These vaccines are designed to provide immunity by exposing the body to killed virus antigens. Puumala virus PUUVsSgp1 (NP) protein vaccine VO_0011400 Subunit vaccine Research Freund's complete and incomplete adjuvants Puumala virus nucleocapsid protein (PUUVsSgp1) Recombinant protein preparation N proteins from PUUV, TOPV, ANDV, and DOBV, carrying a polyhistidine tag to facilitate protein purification, were produced in Escherichia coli cells. The N ORF of PUUV, TOPV, and DOBV were cloned into the pQE-32 vector (Qiagen, Hilden, Germany), while the N ORF of ANDV was cloned into pRSET (R&D Systems Europe, Oxford, United Kingdom). An irrelevant protein, mouse dihydrofolate reductase (DHFR) (Qiagen), provided by the manufacturer and expressed in the same system, was used as a negative control protein (de et al., 2002). To asses the immunogenicity and protective capacity of the expressed rN proteins, 4- to 10-week-old bank voles, derived from a PUUV-free colony established with animals captured in Sweden, were immunized with purified PUUV, TOPV, ANDV, or DOBV rN or DHFR control protein. Bank voles were immunized three times with 50 μg of protein at intervals of 3 weeks. The animals were injected with protein emulsified in Freund's complete adjuvant, incomplete Freund's adjuvant, and phosphate-buffered saline (PBS), respectively (de et al., 2002). To investigate the ability of recombinant N (rN, nucleocapsid proteins) from different hantaviruses to elicit cross-protection, we immunized bank voles with rN from Puumala (PUUV), Topografov (TOPV), Andes (ANDV), and Dobrava (DOBV) viruses and subsequently challenged them with PUUV. All animals immunized with PUUV (PUUVsSgp1) and TOPV rN were completely protected (de et al., 2002). Bank voles were challenged subcutaneously 2 weeks after the last immunization with approximately 20 50% infective doses of wild-type PUUV (strain Kazan) (de et al., 2002). Recombinant DOBV nucleocapsid protein (rDOBV N) VO_0004102 Subunit vaccine Dobrava hantavirus (DOBV) causes a severe form of hemorrhagic fever with renal syndrome (HFRS). Currently there is no therapy or vaccine available for HFRS (Klingstrom et al., 2004). Dobrava hantavirus nucleocapsid protein in Freund's adjuvant (Klingstrom et al., 2004). Not virulent Recombinant DOBV nucleocapsid protein (rDOBV N) given with Alum or Freund's as adjuvant (Klingstrom et al., 2004). Recombinant protein preparation Dobrava hantavirus nucleocapsid protein was used for the vaccine development (Klingstrom et al., 2004). C57/BL6 mice His-tagged rDOBV N and recombinant mouse dihydrofolate reductase (rDHFR) was emulsified with Imject® Alum (Pierce, Rockford, IL), Freund’s complete adjuvant (FCA) or incomplete (FIA) adjuvant (Sigma, St. Louis, MO) or PBS. A total of 50 μg of recombinant protein was mixed with Alum and FCA/FIA, or PBS, in a total volume of 200 μl per dosage. All immunizations and boosters were administered subcutaneously. rDOBV N or rDHFR in Alum, FCA or PBS were administered at day 0. At days 21 and 92, mice were boosted with rDOBV N or rDHFR in Alum, FIA or PBS. At day 118, all mice were challenged with 10 mouse ID50 of DOBV and 21 days later, all mice were sacrificed. Serum, plasma, and EDTA-blood were drawn at the time points indicated below (Klingstrom et al., 2004). The immunogenicity and protective efficacy of recombinant DOBV nucleocapsid protein (rDOBV N) given with Alum or Freund’s as adjuvant, or PBS, in C57/BL6 mice, were compared. All mice given Alum or Freund’s seroconverted as did 6/8 mice given rDOBV N with PBS. Reciprocal geometric mean total IgG-titers were 5380, 18,100, and 800, respectively, while the mean IgG1/IgG2a ratios were 17.5, 9.25, and 12, respectively. Furthermore, ELIspot assays showed higher levels of IL-4 producing peripheral blood mononuclear cells (PBMCs) in the group given Alum as compared to the other groups. Interestingly, only mice receiving rDOBV N with Freund’s adjuvant were protected from challenge (75% protected), indicating that the strong Th2-type of immune response induced by Alum against rDOBV N did not induce protection in mice (Klingstrom et al., 2004). No side effects. All vaccinated mice were subcutaneously challenged with 10 mouse ID50 DOBV at day 118. The challenge did not kill mice. Three weeks after challenge, the mice were sacrificed and serum tested for the presence of neutralizing antibodies (Klingstrom et al., 2004). rVSVΔG-ANDV-GPC VO_0004662 Recombinant vector vaccine Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) Syrian hamsters were immunized with a single injection of VSVΔG/ANDVGPC (Brown et al., 2011). VO_0000287 The hamsters were fully protected against the disease; however, the mechanism of protection seems to differ depending on when the immunization occurs. Administration of the vaccine at 7 or 3 days before challenge also resulted in full protection but with no specific neutralizing humoral immune response, suggesting a possible role of innate responses in protection against challenge virus replication. Administration of the vaccine 24 h postchallenge was successful in protecting 90% of hamsters and again suggested the induction of a potent antiviral state by the recombinant vector as a potential mechanism (Brown et al., 2011). After immunization, the hamsters were challenged at 28, 14, 7, or 3 days postimmunization with a lethal dose of ANDV (Brown et al., 2011). Seoul virus vaccine rCAV-2-Gc VO_0011402 Recombinant vector vaccine Research replication-competent recombinant canine adenovirus type 2 Intramuscular injection (i.m.) Intramuscular injection (i.m.) Seoul virus Gc glycoprotein Recombinant protein preparation The Gc protein expressed by rCAV-2-Gc in MDCK cells was evaluated by a SEOV-specific indirect IFA. MDCK cells grown on 15 mm glass coverslips in 12-well culture plates were infected with rCAV-2-Gc or CAV-2 at an m.o.i. of 20. After 48 h infection, the coverslips were rinsed once with PBS (pH 7.4), fixed with acetone for 10 min at room temperature and then reacted with rabbit anti-SEOV polyclonal antiserum and washed three times with PBS. The fixed monolayers were incubated at 37 °C for 30 min in a moist chamber with donkey anti-rabbit IgG labelled with fluorescence isothiocyanate (Amersham). The coverslips were rinsed three times with PBS. Cell monolayers that bound the antibody were covered with glycerine and examined for specific fluorescence under a Zeiss Axioplan fluorescence microscope. Expression of SEOV Gc in MDCK cells infected with rCAV-2-Gc was identified by Western blotting. rCAV-2-Gc-infected cell lysates were separated by 12 % SDS-PAGE, and the proteins transferred to nitrocellulose membrane (Pall Corporation) and probed with positive serum against SEOV and HRP-labelled goat anti-mouse IgG antibody (Sigma) (Yuan et al., 2010). BALB/c Mice were randomly assigned to four experimental groups (20 mice per group). Group I was intramuscularly inoculated once with 0.1 ml rCAV-2-Gc (108.0 p.f.u. ml–1); group II received 0.1 ml CAV-2 (108.2 p.f.u. ml–1) intramuscularly as a negative control; group III were inoculated intramuscularly with one dose of HFRS bivalent purified vaccine Youerjian (0.5 ml per dose; GuangDong HongMing Biological Science and Technology Co.) as a positive-control; and group IV were injected with 0.1 ml PBS as a negative control (Yuan et al., 2010). eplication-competent recombinant canine adenovirus type 2 expressing the Gc protein of SEOV (rCAV-2-Gc) in BALB/c mice induced complete protection against a intensive infectious challenge with ~1,000 50% infective doses (ID50) for SEOV strain CC-2 (Yuan et al., 2010). At the end of the trial, all mice were injected intramuscularly with SEOV strain CC-2 diluted in 0.2 ml PBS. The challenge dose for each virus was 2000 p.f.u. This dose is 1000 50 % infective doses for SEOV. At 14 days after challenge, the mice were sacrificed by CO2 asphyxiation, as approved by the China Small Animal Protection Association. Pre- and post-challenge sera were evaluated for the presence of N-specific antibodies by ELISA and for the presence of neutralizing antibodies by FRNT. Detecting post-challenge N-specific antibody indicated that the mice were infected with the challenge virus (Yuan et al., 2010). Sin Nombre virus DNA vaccine encoding G1 VO_0011401 DNA vaccine Research CMV expression vector pCMVi (-H3) UBs Sin Nombre virus envelope glycoprotein G1 DNA vaccine construction Cloned the G1 and G2 glycoprotein genes of SN virus strain CC107 into the CMV expression vector pCMVi (-H3) UBs (Bharadwaj et al., 1999 ). The M segment fragments 3' of the first fragment were prepared in a similar manner, such that each expression construct shared 100 nt of sequence at the 5' end with the 3' end of the fragment that preceded it. The coordinates of each of the ten glycoprotein fragments, designated M-CMV-A thorough -I. We also cloned the entire SN virus N gene in a single fragment in a separate expression construct. The same viral cDNA fragments were cloned into bacterial expression vectors to allow bacterial synthesis of the cognate antigens as fusion proteins, as described (Bharadwaj et al., 1997 ; Yamada et al., 1995 ) (Bharadwaj et al., 2002). We purified plasmid DNA with an endotoxin-free kit (EndoFree, Qiagen), and dissolved DNA to a concentration of 1 mg/ml in 0·9% NaCl. Five to twelve mice were immunized with each construct three times at 4 week intervals, using 50 µg of plasmid into each set of quadriceps muscles for a total of 100 µg. No adjuvants were used (Bharadwaj et al., 2002). Study used a deer mouse infection model to test the protective efficacy of genetic vaccine candidates for Sin Nombre (SN) virus that were known to provoke immunological responses in BALB/c mice. Protective epitopes were localized in each of four overlapping cDNA fragments that encoded portions of the SN virus G1 glycoprotein antigen; the nucleocapsid gene also was protective (Bharadwaj et al., 2002). Challenged the mice in the challenge replicate with 5 ID50 of SN77734 by the i.m. route 2 weeks after the third vaccination, a dose that corresponds roughly to 50–200 focus-forming units (Bharadwaj et al., 2002). Sin Nombre virus DNA vaccine encoding SNVsSgp1 (NP) VO_0011543 DNA vaccine Research CMV expression vector pCMVi (-H3) UBs Sin nombre virus nucleocapsid protein (SNVsSgp1) DNA vaccine construction Cloned the G1 and G2 glycoprotein genes of SN virus strain CC107 into the CMV expression vector pCMVi (-H3) UBs (Bharadwaj et al., 1999 ). The M segment fragments 3' of the first fragment were prepared in a similar manner, such that each expression construct shared 100 nt of sequence at the 5' end with the 3' end of the fragment that preceded it. The coordinates of each of the ten glycoprotein fragments, designated M-CMV-A thorough -I. We also cloned the entire SN virus N gene in a single fragment in a separate expression construct. The same viral cDNA fragments were cloned into bacterial expression vectors to allow bacterial synthesis of the cognate antigens as fusion proteins (Bharadwaj et al., 2002). Five to twelve mice were immunized with each plasmid DNA construct three times at 4 week intervals, using 50 µg of plasmid into each set of quadriceps muscles for a total of 100 µg. No adjuvants were used (Bharadwaj et al., 2002). Study used a deer mouse infection model to test the protective efficacy of genetic vaccine candidates for Sin Nombre (SN) virus that were known to provoke immunological responses in BALB/c mice. Protective epitopes were localized in each of four overlapping cDNA fragments that encoded portions of the SN virus G1 glycoprotein antigen; the nucleocapsid gene (SNVsSgp1) also was protective (Bharadwaj et al., 2002). Challenged the mice in the challenge replicate with 5 ID50 of SN77734 by the i.m. route 2 weeks after the third vaccination, a dose that corresponds roughly to 50–200 focus-forming units (Bharadwaj et al., 2002). Topografov virus N protein vaccine VO_0011403 Subunit vaccine Research Freund's complete and incomplete adjuvants Topografov virus Nucleocapsid protein Recombinant protein preparation To asses the immunogenicity and protective capacity of the expressed rN proteins, 4- to 10-week-old bank voles, derived from a PUUV-free colony established with animals captured in Sweden, were immunized with purified PUUV, TOPV, ANDV, or DOBV rN or DHFR control protein. Bank voles were immunized three times with 50 μg of protein at intervals of 3 weeks. The animals were injected with protein emulsified in Freund's complete adjuvant, incomplete Freund's adjuvant, and phosphate-buffered saline (PBS), respectively (de et al., 2002). To investigate the ability of recombinant N (rN, nucleocapsid proteins) from different hantaviruses to elicit cross-protection, we immunized bank voles with rN from Puumala (PUUV), Topografov (TOPV), Andes (ANDV), and Dobrava (DOBV) viruses and subsequently challenged them with PUUV. All animals immunized with PUUV and TOPV rN were completely protected (de et al., 2002). Bank voles were challenged subcutaneously 2 weeks after the last immunization with approximately 20 50% infective doses of wild-type PUUV (strain Kazan) (de et al., 2002). Truncated Recombinant DoBV Nucleocapsid Proteins (Dob-N rNp) VO_0004103 Subunit vaccine Dob-N rNp was emulsifi ed in 2% Alhydrogel (Accurate Chemical & Scientific Corp., Westbury, N.Y., USA). The rNp P40-Dob-N, P40-Dob118 and P40p-Dob118 were administered in sterile PBS (Maes et al., 2006). Not virulent DOBV RNA (strain DOB-90/5) was extracted from infected Vero E6 cells (CRL 1586; ATCC, USA). The genomic RNA of DOBV was reverse-transcribed and PCR amplified in order to generate the entire S-segment, using following oligonucleotide primers: 5'-GCGAATTCGCAACACTAGAGGAACTCCAAAAGG-3' and 5'-CGAAGCTTAGTGGTGGTGGTGGTGGTGAAGTTTGAGCGGCTCC-3'. The amino-terminal part encoding the first 118 amino acids was generated using 5'-CTGGCGCCTAACCGACGTGGTGGTGGTGGTGGTGATTCGAAGC-3' as reverse primer. In all constructs, a histidine (His) tag was introduced at the C-terminal end. PCR fragments were cloned in plasmids pTEX(rP40) or pTEXmp18 respectively with or without the inclusion of the P40 sequence in the construct. Following transformation of the E. coli ICONE 200 strain, the recombinant proteins were produced as intracellular inclusion bodies, recovered, and renatured. The recombinant proteins were purifi ed by metal chelate affinity chromatography using a HisTrap kit (Pharmacia, Puurs, Belgium). Using this protocol, four DOBV rNp constructs were expressed and purified. The complete nucleocapsid protein of DOBV was expressed with or without the addition of the rP40 protein (constructs P40-Dob-N and Dob-N). The amino-terminal part of the DOBV nucleocapsid protein was expressed with the addition of the rP40 protein (construct P40-Dob118) or with the addition of only the periplasmic part of the rP40 protein (construct P40p-Dob118) (Maes et al., 2006). NMRI mice (Elevage Janvier, Le Genest Saint Isle, France) Groups of ten 6-week-old NMRI mice (Elevage Janvier, Le Genest Saint Isle, France) were immunized three times subcutaneously with three different concentrations (0.2, 2 and 10 ug) of rNp with intervals of 2 weeks. The animals were injected with Dob-N rNp emulsifi ed in 2% Alhydrogel (Accurate Chemical & Scientific Corp., Westbury, N.Y., USA). The rNp P40-Dob-N, P40-Dob118 and P40p-Dob118 were administered in sterile PBS. Blood was drawn 14 days after each immunization (Maes et al., 2006). N/A All recombinant proteins were found to be highly immunogenic after three immunizations of rNp. The immunizations resulted in the induction of a strong Np-specific IgG response with a predominance of IgG1 over IgG2b and IgG2a, suggesting a mixed Th1/Th2 cell involvement. A specific IgG3 response could not be detected. Mice immunized with recombinant DOBV rNp without rP40 showed lower nucleocapsid-specific antibody responses in comparison with the rP40-conjugated constructs, but all mice were found to be protected against DOBV challenge. The results indicate that the rNp constructs coupled to rP40, represent promising vaccine candidates (Maes et al., 2006). None. Groups of 10 NMRI mice were immunized three times subcutaneously with 10 ug of the different constructs with intervals of 2 weeks, and were challenged intraperitoneal with DOBV 2 weeks after the last immunization. Three weeks later, all mice were sacrificed and serum samples were collected. Mice immunized three times subcutaneously with 10 ug of rP40 were used as a control group (Maes et al., 2006). ANDVsSgp1 Andes orthohantavirus VO_0011092 991232 19744950 ANDVsSgp1 AF004660 NP_604471 1980456 Segment S 42 1328 + nucleocapsid protein 7.18 45461.89 428 >NC_003466.1:42-1328 Andes virus segment S, complete sequence AATGAGCACCCTCCAAGAATTGCAGGAAAACATCACAGCACACGAACAACAGCTCGTGACTGCTCGGCAA AAGCTTAAGGATGCCGAGAAGGCAGTGGAGGTGGACCCGGATGACGTTAACAAGAGCACACTACAAAGTA GACGGGCAGCTGTGTCTACATTGGAGACCAAACTCGGAGAACTTAAGAGGCAACTTGCAGATTTGGTGGC AGCTCAAAAATTGGCTACAAAACCAGTTGATCCAACAGGGCTTGAGCCTGATGATCATCTAAAGGAAAAA TCATCTCTGAGATATGGGAATGTCCTGGATGTTAATTCAATTGATTTGGAAGAACCGAGTGGACAGACTG CTGATTGGAAGGCTATAGGAGCATACATCTTAGGGTTTGCAATTCCGATCATCCTAAAGGCCTTATACAT GCTGTCAACCCGTGGGAGACAAACTGTGAAAGACAACAAAGGGACCAGGATAAGGTTTAAGGATGATTCT TCCTTTGAAGAAGTCAATGGGATACGTAAACCAAAACACCTTTACGTCTCAATGCCAACTGCACAGTCCA CTATGAAGGCTGAAGAAATCACGCCAGGACGATTTAGGACAATTGCTTGTGGCCTTTTTCCAGCACAGGT CAAAGCCCGAAATATAATAAGTCCTGTAATGGGAGTAATTGGATTTGGCTTCTTTGTAAAGGATTGGATG GATCGGATAGAAGAGTTTCTGGCTGCAGAGTGTCCATTCTTACCTAAGCCAAAGGTCGCCTCAGAAGCCT TCATGTCTACCAATAAGATGTATTTTCTGAACAGACAGAGACAAGTCAATGAATCTAAGGTTCAAGATAT TATCGATTTGATAGACCATGCTGAGACCGAGTCTGCTACCTTGTTTACAGAGATTGCAACACCCCATTCA GTCTGGGTGTTTGCATGTGCACCTGACCGGTGCCCTCCAACTGCATTGTATGTTGCAGGGGTACCGGAAC TTGGTGCATTTTTTTCTATCCTTCAGGACATGCGTAATACCATCATGGCATCTAAATCTGTAGGGACTGC AGAAGAGAAGCTAAAGAAAAAATCTGCCTTCTACCAATCATACCTAAGAAGGACACAATCTATGGGAATC CAACTGGACCAGAAGATCATAATCCTTTACATGCTATCATGGGGTAAAGAAGCTGTGAATCACTTCCATC TTGGTGATGATATGGACCCTGAACTCAGGCAGCTAGCACAATCTCTGATCGATACTAAGGTGAAGGAGAT CTCCAACCAAGAGCCACTTAAGTTGTA >NP_604471.1 nucleocapsid protein [Andes orthohantavirus] MSTLQELQENITAHEQQLVTARQKLKDAEKAVEVDPDDVNKSTLQSRRAAVSTLETKLGELKRQLADLVA AQKLATKPVDPTGLEPDDHLKEKSSLRYGNVLDVNSIDLEEPSGQTADWKAIGAYILGFAIPIILKALYM LSTRGRQTVKDNKGTRIRFKDDSSFEEVNGIRKPKHLYVSMPTAQSTMKAEEITPGRFRTIACGLFPAQV KARNIISPVMGVIGFGFFVKDWMDRIEEFLAAECPFLPKPKVASEAFMSTNKMYFLNRQRQVNESKVQDI IDLIDHAETESATLFTEIATPHSVWVFACAPDRCPPTALYVAGVPELGAFFSILQDMRNTIMASKSVGTA EEKLKKKSAFYQSYLRRTQSMGIQLDQKIIILYMLSWGKEAVNHFHLGDDMDPELRQLAQSLIDTKVKEI SNQEPLKL Protective antigen Nonreplicating adenovirus (Ad) vectors that express Andes hantavirus (ANDV) nucleocapsid protein (AdN, ANDVsSgp1) or glycoproteins (AdG(N) and AdG(C)) were constructed . When administered once, all three Ad vectors, individually or in combination, elicited a robust immune response that protected Syrian hamsters from a lethal ANDV infection that mimics the pulmonary disease seen in humans. No vaccinated animal died, and there were no obvious clinical signs of disease [Ref1104:Safronetz et al., 2009]. G1 Sin Nombre virus VO_0011086 1113859 2K9H CDD:279853 1980491 ? envelope glycoprotein G1 5.59 9420.59 169 SNV >AAC54579.1 envelope glycoprotein G1, partial [Sin Nombre orthohantavirus] FLVVLTTATAGLTRNLYELKIECPHTVGLGQGYVTGSVETTPVLFSQVADLKIESSCNFDLHVPATTTQK YNQVDWTKKSSTTENTNAGAS Protective antigen Study used a deer mouse infection model to test the protective efficacy of genetic vaccine candidates for Sin Nombre (SN) virus that were known to provoke immunological responses in BALB/c mice. Protective epitopes were localized in each of four overlapping cDNA fragments that encoded portions of the SN virus G1 glycoprotein antigen; the nucleocapsid gene also was protective [Ref1101:Bharadwaj et al., 2002]. Gc Seoul virus VO_0011085 284157806 CDD:144961 1980490 ? Gc glycoprotein 6.5 11999.31 170 Hantavirus glycoprotein G2; pfam01561 >ADB80030.1 Gc glycoprotein, partial [Seoul orthohantavirus] VPLWTDNAHGVGSVPMHTDLELDFSLPSSSKYTYKRHLTNPVNDQQSVSLHIEIESQGIGADVHHLGHWY DARLNLKTSFHCYGACTKYQYPWHTAKCHFEKDYEY Protective antigen Seoul virus (SEOV) is one of the four known hantaviruses causing hemorrhagic fever with renal syndrome (HFRS). A replication-competent recombinant canine adenovirus type 2 expressing the Gc protein of SEOV (rCAV-2-Gc) in BALB/c mice induced complete protection against a intensive infectious challenge with ~1,000 50% infective doses (ID50) for SEOV strain CC-2 [Ref1100:Yuan et al., 2010]. GP Hantaan virus 76-118 138339 CDD:279853 CDD:119058 CDD:144961 11602 ? Envelopment polyprotein 7.1 122560.28 1460 Glycoprotein precursor; M polyprotein >sp|P08668.1|GP_HANTV RecName: Full=Envelopment polyprotein; AltName: Full=Glycoprotein precursor; AltName: Full=M polyprotein; Contains: RecName: Full=Glycoprotein N; Short=Gn; AltName: Full=Glycoprotein G2; Contains: RecName: Full=Glycoprotein C; Short=Gc; AltName: Full=Glycoprotein G1; Flags: Precursor MGIWKWLVMASLVWPVLTLRNVYDMKIECPHTVSFGENSVIGYVELPPVPLADTAQMVPESSCNMDNHQS LNTITKYTQVSWRGKADQSQSSQNSFETVSTEVDLKGTCVLKHKMVEESYRSRKSVTCYDLSCNSTYCKP TLYMIVPIHACNMMKSCLIALGPYRVQVVYERSYCMTGVLIEGKCFVPDQSVVSIIKHGIFDIASVHIVC FFVAVKGNTYKIFEQVKKSFESTCNDTENKVQGYYICIVGGNSAPIYVPTLDDFRSMEAFTGIFRSPHGE DHDLAGEEIASYSIVGPANAKVPHSASSDTLSLIAYSGIPSYSSLSILTSSTEAKHVFSPGLFPKLNHTN CDKSAIPLIWTGMIDLPGYYEAVHPCTVFCVLSGPGASCEAFSEGGIFNITSPMCLVSKQNRFRLTEQQV NFVCQRVDMDIVVYCNGQRKVILTKTLVIGQCIYTITSLFSLLPGVAHSIAVELCVPGFHGWATAALLVT FCFGWVLIPAITFIILTVLKFIANIFHTSNQENRLKSVLRKIKEEFEKTKGSMVCDVCKYECETYKELKA HGVSCPQSQCPYCFTHCEPTEAAFQAHYKVCQVTHRFRDDLKKTVTPQNFTPGCYRTLNLFRYKSRCYIF TMWIFLLVLESILWAASASETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQS IDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDC PGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKF SQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNM VSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIE GAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGED CSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGNWIVLIVLCVFLLFSL VLLSILCPVRKHKKS Protective antigen Hanta_G2 Andes virus Case T isolate 2801763 2801763 AAB97456 Accession:AAB97456; GI:2801763 ? Andes Hantavirus M segment polyprotein >gi|2801762|gb|AF042137.1|AF042137 Andes virus Case T M segment polyprotein gene, partial cds AAGGAAATACCATTTCTGGATATAAAAGAATGATGGCAACAAAAGATTCATTCCAATCGTTTAACTTAAC AGAACCTCACATCACAGCAAATAAGCTTGAATGGATTGACCCAGATGGAAATACAAGAGACCATGTAAAT CTTGTCTTAAATAGAGATGTTTCATTT >gi|2801763|gb|AAB97456.1| M segment polyprotein [Andes virus] GNTISGYKRMMATKDSFQSFNLTEPHITANKLEWIDPDGNTRDHVNLVLNRDVSF Il2 Mus musculus 16183 7110653 DN-144H19.3 AF195954 NP_032392 10090 3 37120712 37125953 - interleukin 2 4.63 18506.61 169 Also known as Il-2 >gi|372099107:37120712-37125953 Mus musculus strain C57BL/6J chromosome 3, GRCm38 C57BL/6J ATTTTTTTTTAGAGGAGAGCTTTATTTCTTGAAAACACTGATTAACATAGAGTTCACAGGAATAACTGAG AAGTTATTTTAGCGCTTACTTTGTGCTGTCCTAAAAATGACAGACATCTGAGCTTATTTATATTTGAATC ATCTAAATACTTTTATTAATGAGTCTACCTACACATGATATTTAACAATTCAATATAATAAATAATTTCA GATAAATAGTTTAAAACATTTTTGAGCCCTTGGGGCTTACAAAAAGAATCTTTAAAGATCCATATTTATC ATCTGAAGACTAGTAGTTACAAAAGATAGTAAACAATACATCCAAAAATAAATTAAAGTTAAATATTTAA ATAAATAGAGAGCCTTATGTGTTGTAAGCAGGAGGTACATAGTTATTGAGGGCTTGTTGAGATGATGCTT TGACAGAAGGCTATCCATCTCCTCAGAAAGTCCACCACAGTTGCTGACTCATCATCGAATTGGCACTCAA ATGTGTTGTCAGAGCCCTAAAAAAGAATATAAAATTGTAGGCTAAGGTAGCTTACTTTGCATATAATTAT TCTTCACGGAAGCTTTTAGGCATTTATTTTAACACTGGTTAAATATATTGAACATTCACATTTCTGAAAT GATCACAATTATTGGGTTATGTTTTATTATGATATCAAATGGTAAAGCATAAAAAATAAAGCTCTCCAGA GTTGATTACCAACGAGCATTTGATGGGAACACTGAACACTTCTGTAGAATTCAGTTGCTTGACCACTTTT TCTCTGGTAAGTGTACACAGCTATGCATCAATTTAGGCTTCAGGAATGGAGAAATGATACTTGTTATATG TTCTTTGCTAAATCTTAAGAGTCTATTATTCAATTCTTTCCCCCCCAAGTCAGAATGGGAACAACCCAGA GTAGGTTAGGACAAGCATCTATTGGGGGAAATTTGGAGAATTTTGTTATAGATATACCTACCCTGATACC AGTGTAGATGAATCACAAAGTTTGTACATGTATAAATATTATAAATTTGTTCTGTGGATTAGCTTTTTGA AAGCTAACCCTCTTTGCTAAAGGAGATATTTTAATTCTGTTTTTAGGTGACAAGCTGAGAAGGAAATATT TTGACAAATTTATGGGATGGCTTTTCCAAATCTGACTAATTCCTTGTAAGTCAAATGAGGCAGATTATTC CTTTTAAATAAATACTCCTTTTCAAATAAGCTGCTGTGGTCTTATATACCCTCTTTACATAGCTACTTCA ATATTCTAATGTCTTGAATTTTTCATTTTTAAAAATATGTGGCCCTTGAAACATTTTTCTAGTTCTCATG TAGCTCTAAAGTTTGTACCATTCATTAGGGGTGAACTTTCTGATGTTGGCCATAGATTTTAGAGCATCCA TCTTTGCATACGTAAGTACTCGATTTTAGAGCATCCATCTTAGCATACGTAAGTACTCACACCTTTCAAC GTCTAGATGATGTGTATTTCAGCCTGCTTTAAAAACCTCAAATGGAAGCTGGGCAGTGGTGGTGCAGGCC TTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGT GAGTTCCAGGACAGCCAGGGCTACACAGAGAAATCCTGTCTCAAAAAAACAAACAAACAAACAAACAAGA AACAAACAAACAAAAAAAACAAAAACAAACAAAACAAAACCTCAAATGGAAACAGTGCACTGAAATGTGA CTTTGGTTTGGAAAGGACTAGCCCACACCCTCTTGGAGGCTTGCTGCTACTGTCTCACCAGAGTCCATGA TTCTTGTGCATTTAAAAACAAAGCTCTGCAGTGGGCTCTCCCCGTCCTGCTCTGTCCATTTTAATGGCTG CCATTTTTGGAGAGAAATGTCTGTTTTTCTACCAATACCAGCACAACTTCTCTGGAAAAACTTTTCAGAT AATTTTTTCTGATCTGATGAATGTAACACCAGCAAGAGTTGCTTGTTTCTTGTGGAATTCTACTCCGTGC TTTCTCTCACATCCAGTTCTATGCTGGTGTGGAGGGAGCAGAGTGTTCATGTTCCCAGTTTCCTTGCAGG TGATGGTAGGTGGAAATTCTAGCATCATCCTACAGTGGAAGGATTCACTTGCACAGTGACTTTAAACTTT GGCTGACTAAATGCACAGAACCCATCAAAGACCAGAAATGGCAAGCCACTTAAAAATGCATTTCTTCTCT ATTTTATTTCCAGATTAGCAAATAAAGCAACACCTTACCTTTAGTTTTACAACAGTTACTCTGATATTGC TGATGAAATTCTCAGCATCTTCCAATTGAAAGCTTTTGCTTTGAGTCAAATCCAGAACATGCCGCAGAGG TCCAAGTTCATCTTCTAGGCACTGAAGATCTTTCAATTCTGTGGCCTAGAGGAGTAATAAGCTTAACCAT CAGCTCAGCTCACCACATACTGAAGAGCCAGAAAGTTAGTCTGCAGTCTCTCTAATCAAGAGAAGGCAGC ACATAGCTTTTACCACTCCCTGTCCTCTGTAAAGGGGGACTGAGGTAATCGATGCCATAAATCTAGAAGA GCAAGAGCTCACAACCATAAGGGTCACCTTGACTGTTAGGCCACTCTAGTGAGCTCTTCTGGCTTCATTA GACTTTGTAAAAAGTCTGTGTTTCTCTACCAATGCATAGCACAAGTTCAGACTATTGTTCCAATCTACAA AGAAATCTGCAAGGTTCACATTCTAATATCTAATCGCAGAGTTGAGAATCACAGAAGGGTAAGGGACAGG AATCCTTGGATGCCAACTGTCATAGGCCTAAATCTTACAGATTAGGTTATCATGGCCCTGACTGAGGGGT GTCAAGATAGCCAGGAAGACACATGTAATATTTTTTAAATTTATACTTCTCTGCAATTACTAAAGATGAG TTTTTTAAAAACCCATATGTCAAGCTAGGAAGATGGCTTTTAAGGTAAAGGTACCTGCCACCAAACTTGA TGATTTGAGTTCAATTGCAGTGACCCACCCACATTGTGGAAAGAATGGCCCAACTTTCATATTTCGTCTT CTGACCTCCACAGTTACACTGTGATACACATGCACCTCCACACATACATACATACATACATACATACATA CATACATACATACATACATACATACATAAAATGTAAAATCTATTTGTCCCAATGAAAAAAGTCATAACAT TTTGGCAGAACACTTGGGAGAATTTTTCTGATCCATGTATGAAATAATGTTTAAATACATCATGCATACT TACATACATATACAGGGAAAAAGGATATTGTCTAGCTCTATAGTACACTATGATTTCCATAAAGTCAGCT GCTTTAAGTCTACAGTGAACTGTGTTATCTCCATTTTACCAAGTCTCACAATCAGTGTCTTTCCCACAAC CACATGAACGGGGAGCAAGGGTGGCCCGGTCGGTCGGTCGCTCCTTTCATTAACCACAGCCTTTGAATTA CATGCTTCTATTGTTTTTAAAATCTTACATACCGAATGCAGGTTAAATGAAAACATCAGCAGAATTTACC ACATTACTCTTGTTTTCAATAATTATTTTAAAACTTAGATTTCTAGGAATTTCACCACTCTCTAAATTAA CATGATCTCTGTTGTTTCTCTAACAATCCTTAGAGGAAGAGGTTTGACAAGATAACACGTAGTTCCTGAT TGGTCTGCTATTGACCTTCCAACTTGTTATGGTGTGTCTTGGGTATTCAGTGTGGAGCTCCTTCCCTCAC AGAACTCTCCAGTTTGTTACTGTGGGAGCTGAACATTATGTGACTGTAATTAAGCTGGAAGAGCAACTGG GGCCTTTCTTTTTCATCTCCTGTAGAACAGCTAGAGGCAAAGTTCCCCTGACTCAATAGGAATGGGTCAA CAGCTGCCTCTTTGTCCCCTTAGATCCCATTTTGCTCTAGGCTTGGATTTACTTGGGACAAGCTCTTTCT AGGACCAAAGTTATCCATTCTCTTTTGACTTTCGGGACTAGAGCAAATTTCTACCCTTGCTGGAGTTCTA AGAGCTTGTGTAAGCTGTTTTGTATCACACAACATTCTGCCTCCAAAGGAGACCAAAAAACCTTTCAATA TTGAGAGATAGTATCATGTAGTAATATTACAGCTCTCTAGTTCCACTAGTTAAAAGAGACTGTATAAATC CAAAATTGTTTTATACATCTCGGACTTCTTCTCTAGCACTAATAGTGTGTTTATGTGCTGTTGGCCAGAC ACTGTTCTGAAACCTGACAAGTGATAAGCATAGCAATGATCATTTATGTAAGTGGGTGAATGAGCATAGA CAACTTCCTGAGGCCATGAGAGCTAGGCCCTAGCAGGGCTGGACTCCACTGCAGATCATTGGCCCTAGAA TCTTAACATTGGTTATGCTGCTCCTCAAAAATGCAGTCATAGGAATCATTCTTAAAACAGTAAAGTGTGT GTAAAATGAGACCCTCTCAAGTCAATTTTTACATTTAAGAAGCTGAAATAATGCACCTCTCTCAAATATC TGTAGGACAAGCATAAAACAGAAATCAACAGTCTTTAAATTATCCCAGCATCAAAATGCAATCATCTTGC ATTTTCTTCTCATTCCCTTTCCCAACACATAAATACACAGGAAAAATGTAAAGAAAACCATTTAAAAGAA GTACCATTGTCAAGATTTTTTTACAGAGAGATATCAGAGAAACTTATTTTCTTCAGATGAGGTACTATTC ATCTGGTCACATGTTATTTACACGTTATACACATGTATGTTACTTTGAATTCATTAGAGCACCAGTTAAA CACAGAAACTCACTCACCTGCTTGGGCAAGTAAAATTTGAAGGTGAGCATCCTGGGGAGTTTCAGGTTCC TGTAATTCTGAGAAAGCGTAACACATTATTATTAAAGGTTATTAAACACAGCCTTTGGCAAGAAAGCTAA AGGTATTGCCTATAGATGGGATGGCTGTGCACTTACCTCCATCCTGCTCAGGAGCTCCTGTAGGTCCATC AACAGCTGCTCCAGGTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTGCTTCCGCTGTAGAGC TTGAAGTGGAGCTTGAAGTGGGTGCGCTGTTGACAAGGAGCACAAGTGTCAATGTGACACAGGATGCGAG CTGCATGCTGTACATGCCTGCAGGACTTGAGGTCACTGTGAGGAGTGATTAGCAAGGGTGAT >gi|7110653|ref|NP_032392.1| interleukin-2 precursor [Mus musculus] MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFEC QFDDESATVVDFLRRWIAFCQSIISTSPQ Vaximmutor Il4 (interleukin 4) Mus musculus 16189 10946584 RP23-188H3.4 NM_021283.1 NM_021283.1 10090 ? IL-4, Interleukin 4 >gi|10946583|ref|NM_021283.1| Mus musculus interleukin 4 (Il4), mRNA GGATCCCCGGGCAGAGCTGGGGGGGGATTTGTTAGCATCTCTTGATAAACTTAATTGTCTCTCGTCACTG ACGGCACAGAGCTATTGATGGGTCTCAACCCCCAGCTAGTTGTCATCCTGCTCTTCTTTCTCGAATGTAC CAGGAGCCATATCCACGGATGCGACAAAAATCACTTGAGAGAGATCATCGGCATTTTGAACGAGGTCACA GGAGAAGGGACGCCATGCACGGAGATGGATGTGCCAAACGTCCTCACAGCAACGAAGAACACCACAGAGA GTGAGCTCGTCTGTAGGGCTTCCAAGGTGCTTCGCATATTTTATTTAAAACATGGGAAAACTCCATGCTT GAAGAAGAACTCTAGTGTTCTCATGGAGCTGCAGAGACTCTTTCGGGCTTTTCGATGCCTGGATTCATCG ATAAGCTGCACCATGAATGAGTCCAAGTCCACATCACTGAAAGACTTCCTGGAAAGCCTAAAGAGCATCA TGCAAATGGATTACTCGTAGTACTGAGCCACCATGCTTTAACTTATGAATTTTTAATGGTTTTATTTTAA TATTTATATATTTATAATTCATAAAATAAAATATTTGTATAATGT >gi|10946584|ref|NP_067258.1| interleukin 4 [Mus musculus] MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCR ASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Vaximmutor IL-4 plays an important role in Th2 immune response. PUUVsSgp1 Puumala orthohantavirus VO_0011088 2943083 38371721 PUUVsSgp1 HE801633 NP_941984 1980486 42 1343 + nucleocapsid protein 6.05 46970.43 433 >NC_005224.1:42-1343 Puumala virus segment S, complete sequence AATGAGTGACTTGACAGATATCCAAGAGGATATAACCCGCCATGAACAGCAACTTATTGTTGCCAGACAA AAACTTAAGGATGCAGAGAGAGCAGTGGAAGTGGACCCAGATGACGTTAATAAAAACACACTGCAAGCCA GGCAACAAACAGTGTCAGCACTGGAGGACAAACTCGCAGACTACAAGAGAAGGATGGCAGATGCTGTGTC CAGGAAAAAAATGGATACTAAACCTACTGACCCGACTGGGATTGAACCTGATGACCACCTCAAGGAGAGA TCAAGCCTTAGGTATGGAAATGTCCTTGATGTAAATGCAATTGACATTGAAGAACCAAGTGGCCAAACAG CAGATTGGTATACAATTGGAGTGTATGTGATAGGGTTCACACTTCCTATCATCCTTAAAGCTTTATACAT GCTCTCAACGCGTGGGAGACAGACTGTAAAGGAAAATAAGGGGACACGTATAAGGTTTAAGGATGATACA TCATTTGAAGACATCAATGGCATAAGGAGACCAAAGCATTTATATGTTTCTATGCCTACTGCCCAGTCAA CTATGAAAGCAGAAGAACTCACACCTGGCAGATTTCGCACAATAGTATGTGGTCTTTTTCCCACTCAGAT CCAGGTTCGTAACATCATGAGTCCAGTTATGGGGGTCATTGGTTTTTCATTCTTTGTGAAGGATTGGTCT GAGAGAATCAGAGAGTTCATGGAAAAAGAGTGCCCATTCATAAAGCCTGAAGTAAAACCAGGCACACCAG CACAGGAGATTGAGATGTTAAAAAGAAATAAGATCTACTTTATGCAGCGCCAGGATGTGCTTGACAAAAA TCATGTGGCAGACATTGACAAGTTAATTGACTATGCAGCCTCTGGAGACCCTACATCACCTGACAACATT GATTCGCCTAATGCACCATGGGTCTTTGCATGTGCACCAGACCGATGCCCACCAACATGTATCTATGTTG CAGGGATGGCAGAGCTTGGGGCCTTTTTTTCAATATTGCAGGACATGAGAAACACAATAATGGCATCTAA GACTGTTGGCACAGCAGAAGAGAAATTAAAGAAAAAGTCTTCCTTTTACCAATCTTACCTGCGTCGAACT CAATCAATGGGAATTCAGCTTGATCAAAGAATTATCCTCTTGTTTATGTTGGAATGGGGCAAAGAGATGG TAGATCACTTCCATCTTGGTGATGATATGGATCCAGAGCTCAGAGGTCTTGCACAGGCACTGATAGATCA AAAGGTCAAGGAAATATCGAACCAGGAACCACTAAAGATATA >NP_941984.1 nucleocapsid protein [Puumala orthohantavirus] MSDLTDIQEDITRHEQQLIVARQKLKDAERAVEVDPDDVNKNTLQARQQTVSALEDKLADYKRRMADAVS RKKMDTKPTDPTGIEPDDHLKERSSLRYGNVLDVNAIDIEEPSGQTADWYTIGVYVIGFTLPIILKALYM LSTRGRQTVKENKGTRIRFKDDTSFEDINGIRRPKHLYVSMPTAQSTMKAEELTPGRFRTIVCGLFPTQI QVRNIMSPVMGVIGFSFFVKDWSERIREFMEKECPFIKPEVKPGTPAQEIEMLKRNKIYFMQRQDVLDKN HVADIDKLIDYAASGDPTSPDNIDSPNAPWVFACAPDRCPPTCIYVAGMAELGAFFSILQDMRNTIMASK TVGTAEEKLKKKSSFYQSYLRRTQSMGIQLDQRIILLFMLEWGKEMVDHFHLGDDMDPELRGLAQALIDQ KVKEISNQEPLKI Protective antigen To investigate the ability of recombinant N (rN, nucleocapsid proteins) from different hantaviruses to elicit cross-protection, we immunized bank voles with rN from Puumala (PUUV), Topografov (TOPV), Andes (ANDV), and Dobrava (DOBV) viruses and subsequently challenged them with PUUV. All animals immunized with PUUV (PUUVsSgp1) and TOPV rN were completely protected [Ref228:de et al., 2002]. S nucleocapsid protein from Dobrava-Belgrade virus Dobrava-Belgrade orthohantavirus VO_0010960 2656266 38505524 DOBVsSp1 AJ410615 NP_942553 GI:63030019; Accession:AY961618.1 1980467 35 1324 + nucleocapsid protein 7.53 46162.49 429 >NC_005233.1:35-1324 Dobrava virus complete S segment gene for nucleocapsid protein, strain DOBV/Ano-Poroia/Afl9/1999 GATGGCAACATTAGAGGAACTCCAAAAAGAAATCAACAACCACGAGGGCCAATTGGTGATAGCCAGGCAG AAGGTGAAAGATGCAGAAAAGCAGTATGAAAAGGATCCTGACGACCTGAATAAAAGGGCATTGAGTGACC GGGAAAGCATTGCACAATCAATTCAGGGAAAAATAGATGAATTAAGGAGACAGCTGGCTGATCGTGTGGC AGCAGGGAAAAACATTGGCAAAGAGAGGGACCCAACTGGACTAGACCCTGGAGATCACCTCAAAGAGAAG TCAATGCTCAGTTATGGAAATGTCATTGACCTCAACCATCTTGACATTGATGAACCTACAGGGCAAACCG CAGACTGGCTGAGCATTGTGGTCTACCTGACATCATTCGTGGTTCCAATATTGTTGAAGGCTCTTTACAT GCTTACCACCAGAGGGAGACAAACTACTAAAGACAATAAGGGAATGAGAATTCGATTTAAGGATGACAGC TCTTTTGAAGATGTGAATGGGATTAGAAAGCCAAAGCACCTGTTCTTGTCAATGCCCAATGCACAATCTA GCATGAAGGCAGATGAGATTACACCAGGTCGGTTCAGGACTGCAATTTGTGGACTATACCCAGCCCAGGT GAAGGCAAGGAACTTAATCAGTCCTGTGATGAGTGTGATTGGGTTTTTAGCCCTTGCAAAGAACTGGACA GAGCGGGTTGAGGAATGGCTTGACCTCCCGTGCAAGCTACTATCTGAGCCATCTCCAACGTCTTTGACCA AAGGCCCATCCACCAATCGTGACTACTTGAATCAAAGACAAGGAGCGCTTGCAAAAATGGAAACAAAAGA AGCTCAGGCTGTGAGGAAACATGCCATAGATGCTGGCTGCAACCTTATCGACCATATAGACTCACCATCA TCAATCTGGGTCTTTGCAGGAGCACCCGACAGATGCCCTCCTACCTGCCTGTTCATTGCAGGCATGGCAG AGCTAGGTGCATTCTTTGCTGTTCTCCAGGATATGAGGAACACCATCATGGCGTCAAAAACTATCGGAAC ATCTGAGGAGAAGCTAAAGAAGAAATCATCTTTTTACCAATCTTACCTACGGAGGACACAATCTATGGGG ATACAACTGGACCAGCGCATCATCGTGCTCTTCATGGTTGACTGGGGAAAAGAGGCAGTTGATAGTTTTC ATCTTGGTGATGATATGGATCCTGAGCTCCGGGGCCTGGCACAGGCATTAATTGATCAAAAAGTGAAGGA AATATCTAATCAGGAACCGCTTAAGCTTTA >NP_942553.1 nucleocapsid protein [Dobrava-Belgrade orthohantavirus] MATLEELQKEINNHEGQLVIARQKVKDAEKQYEKDPDDLNKRALSDRESIAQSIQGKIDELRRQLADRVA AGKNIGKERDPTGLDPGDHLKEKSMLSYGNVIDLNHLDIDEPTGQTADWLSIVVYLTSFVVPILLKALYM LTTRGRQTTKDNKGMRIRFKDDSSFEDVNGIRKPKHLFLSMPNAQSSMKADEITPGRFRTAICGLYPAQV KARNLISPVMSVIGFLALAKNWTERVEEWLDLPCKLLSEPSPTSLTKGPSTNRDYLNQRQGALAKMETKE AQAVRKHAIDAGCNLIDHIDSPSSIWVFAGAPDRCPPTCLFIAGMAELGAFFAVLQDMRNTIMASKTIGT SEEKLKKKSSFYQSYLRRTQSMGIQLDQRIIVLFMVDWGKEAVDSFHLGDDMDPELRGLAQALIDQKVKE ISNQEPLKL Protective antigen Study compared the immunogenicity and protective efficacy of recombinant DOBV nucleocapsid protein (rDOBV N, S) given with Alum or Freund's as adjuvant, or PBS, in C57/BL6 mice. Mice receiving rDOBV N with Freund's adjuvant were protected from challenge (75% protected) [Ref229:Klingstrom et al., 2004]. S segment Topografov virus VO_0011089 4757106 CDD:279218 GOA:Q9WMG3 InterPro:IPR002214 UniProtKB/TrEMBL:Q9WMG3 83192 ? N protein 5.8 47447.65 487 Hantavirus nucleocapsid protein; pfam00846 >CAB42097.1 N protein [Topografov hantavirus] MSNLKDIQDEITRYEQQLIVARQKLRDAEKTVEVDPDDVNKNTLQARRQTVSALEDKLADFKRQLADHVS RQKMDEKPSDPTGIEPDDHLKERSSLRYGNVLDVNAIDIEEPSGQTADWFTIGVYIVSFTLPIILKALYM LSTRGRQTVKENKGTRIRFKDDSSFEDVNGIRRPKHLYVSMPTAQSTMKAEELTPGRFRTIVCGLFPAQI QARNIMSPVMGVIGFSFFVKDWPERIKNFLESKCPFIKPEVKPGAPAGEADFLSRNQIYFMRRQEVLEDN HIPDIDKLLEYASSGDPTAPDSIESPYAPWVFACAPDRCPPTCIYIAGMAELGAFFSILQDMRNTIMASK TVGTAEEKLKKKSSFYQSYLRRTQSMGIQLDQRIILLYMVEWGKEMVDHFHLGDDMDPDLRNLAQSLIDQ KVKEISNQEPLKI Protective antigen To investigate the ability of recombinant N (rN, nucleocapsid proteins) from different hantaviruses to elicit cross-protection, we immunized bank voles with rN from Puumala (PUUV), Topografov (TOPV), Andes (ANDV), and Dobrava (DOBV) viruses and subsequently challenged them with PUUV. All animals immunized with PUUV and TOPV rN were completely protected [Ref228:de Carvalho Nicacio et al., 2002]. SNVsSgp1 Sin Nombre orthohantavirus VO_0011087 2943142 38371726 SNVsSgp1 JQ690276 NP_941975 1980491 segment S 42 1328 + nucleocapsid protein 6.64 45894.2 428 putative >NC_005216.1:42-1328 Sin Nombre virus segment S, complete sequence AATGAGCACCCTCAAAGAAGTGCAAGACAACATCACTCTCCACGAACAACAACTCGTGACTGCCAGGCAG AAGCTCAAAGATGCAGAAAGAGCGGTGGAATTGGACCCCGATGATGTTAACAAAAGCACATTACAGAGCA GACGGGCAGCTGTGTCTGCATTGGAGACCAAACTCGGAGAACTTAAGCGGGAACTGGCTGATCTTATTGC AGCTCAGAAATTGGCTTCAAAACCTGTTGATCCAACAGGGATTGAACCTGATGACCATCTAAAGGAAAAG TCATCATTGAGATATGGAAATGTCCTTGATGTAAATTCCATTGACTTAGAAGAGCCAAGTGGGCAAACAG CTGATTGGAAATCCATCGGACTCTACATTCTAAGTTTCGCATTACCGATTATTCTTAAAGCCTTGTACAT GTTATCTACTAGGGGCCGTCAAACAATCAAAGAAAACAAGGGAACAAGAATTCGATTCAAGGATGATTCA TCTTATGAAGAAGTCAATGGGATACGTAAGCCAAGACATCTGTATGTTTCTATGCCAACTGCCCAGTCTA CAATGAAAGCAGATGAGATTACTCCCGGGAGGTTCCGTACAATTGCTTGTGGATTATTCCCAGCCCAAGT CAAAGCAAGGAATATTATCAGTCCTGTCATGGGTGTGATTGGCTTTAGTTTTTTTGTGAAAGATTGGATG GAAAGGATTGATGACTTCCTGGCTGCACGTTGCCCATTTCTGCCTGAGCAGAAAGACCCTAGAGATGCTG CATTGGCAACTAATAGAGCCTATTTTATAACACGTCAATTACAGGTTGATGAGTCAAAGGTTAGTGATAT TGAGGACCTGATTGCTGATGCAAGGGCTGAGTCTGCCACTATATTCGCAGATATTGCTACTCCTCATTCA GTTTGGGTCTTTGCATGTGCTCCAGATCGTTGTCCACCTACAGCATTATATGTGGCCGGGATGCCGGAAC TGGGTGCATTTTTTGCTATTCTCCAGGATATGAGGAACACCATAATGGCATCCAAATCTGTGGGGACATC TGAAGAGAAATTGAAGAAGAAATCAGCATTCTACCAGTCATACTTAAGACGTACTCAGTCAATGGGAATT CAACTGGACCAGAAGATAATCATCTTATACATGAGCCATTGGGGAAGAGAGGCCGTGAATCACTTCCATC TTGGAGATGATATGGATCCTGAGCTTAGGGAACTTGCCCAGACCCTTGTAGATATCAAGGTCAGGGAAAT CTCTAACCAAGAACCACTTAAACTTTA >NP_941975.1 nucleocapsid protein [Sin Nombre orthohantavirus] MSTLKEVQDNITLHEQQLVTARQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIA AQKLASKPVDPTGIEPDDHLKEKSSLRYGNVLDVNSIDLEEPSGQTADWKSIGLYILSFALPIILKALYM LSTRGRQTIKENKGTRIRFKDDSSYEEVNGIRKPRHLYVSMPTAQSTMKADEITPGRFRTIACGLFPAQV KARNIISPVMGVIGFSFFVKDWMERIDDFLAARCPFLPEQKDPRDAALATNRAYFITRQLQVDESKVSDI EDLIADARAESATIFADIATPHSVWVFACAPDRCPPTALYVAGMPELGAFFAILQDMRNTIMASKSVGTS EEKLKKKSAFYQSYLRRTQSMGIQLDQKIIILYMSHWGREAVNHFHLGDDMDPELRELAQTLVDIKVREI SNQEPLKL Protective antigen Study used a deer mouse infection model to test the protective efficacy of genetic vaccine candidates for Sin Nombre (SN) virus that were known to provoke immunological responses in BALB/c mice. Protective epitopes were localized in each of four overlapping cDNA fragments that encoded portions of the SN virus G1 glycoprotein antigen; the nucleocapsid gene (SNVsSgp1) also was protective [Ref1101:Bharadwaj et al., 2002]. Bharadwaj et al., 2002 journal Bharadwaj M, Mirowsky K, Ye C, Botten J, Masten B, Yee J, Lyons CR, Hjelle B 2002 83 Pt 7 1745-1751 The Journal of general virology Brown et al., 2011 journal Brown KS, Safronetz D, Marzi A, Ebihara H, Feldmann H 2011 85 23 12781-12791 Journal of virology CDC Hantaviruses website http://0-www.cdc.gov.mill1.sjlibrary.org/ncidod/diseases/hanta/hps/ Chu et al., 1995 journal Chu YK, Jennings GB, Schmaljohn CS 1995 69 10 6417-6423 Journal of virology Custer et al., 2003 journal Custer DM, Thompson E, Schmaljohn CS, Ksiazek TG, Hooper JW 2003 Sep 77 18 9894-905 Journal of virology de Carvalho Nicacio et al., 2002 journal de Carvalho Nicacio C, Gonzalez Della Valle M, Padula P, Bjorling E, Plyusnin A, Lundkvist A 2002 Jul 76 13 6669-77 Journal of virology Hooper et al., 2001 journal Hooper JW, Custer DM, Thompson E, Schmaljohn CS 2001 75 18 8469-8477 Journal of virology Klingstrom et al., 2004 journal Klingstrom J, Maljkovic I, Zuber B, Rollman E, Kjerrstrom A, Lundkvist A 2004 Sep 28 22 29-30 4029-34 Vaccine Kruger et al., 2001 journal Kruger DH, Ulrich R, Lundkvist A A 2001 Nov 3 13 1129-44 Microbes and infection / Institut Pasteur Lednicky, 2003 journal Lednicky JA 2003 Jan 127 1 30-5 Archives of pathology & laboratory medicine Maes et al., 2006 journal Maes P, Keyaerts E, Bonnet V, Clement J, Avsic-Zupanc T, Robert A, Van Ranst M 2006 49 5 253-60 Intervirology Safronetz et al., 2009 journal Safronetz D, Hegde NR, Ebihara H, Denton M, Kobinger GP, St Jeor S, Feldmann H, Johnson DC 2009 83 14 7285-7295 Journal of virology Ulrich et al., 1998 journal Ulrich R, Lundkvist A, Meisel H, Koletzki D, Sjolander KB, Gelderblom HR, Borisova G, Schnitzler P, Darai G, Kruger DH 1998 Jan-Feb 16 2-3 272-80 Vaccine Yoshimatsu et al., 1993 journal Yoshimatsu K, Yoo YC, Yoshida R, Ishihara C, Azuma I, Arikawa J 1993 130 3-4 365-376 Archives of virology Yuan et al., 2010 journal Yuan ZG, Luo SJ, Xu HJ, Wang XH, Li J, Yuan LG, He LT, Zhang XX 2010 The Journal of general virology