Hepatitis D virus 12475 Humans (A.D.A.M. Medical Encyclopedia) HDV is found only in people who have Hepatitis B virus. It may make symptoms of hepatitis B worse or may cause symptoms in people who carry hepatitis B virus but have never displayed symptoms (A.D.A.M. Medical Encyclopedia). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27 VO_0004529 DNA vaccine Research pcDNA3 prime, Ad5/Ad5F35-vector boost [Ref2646:Fiedler et al., 2013] Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction VO_0000286 Immunization with DNA plasmid prime administered via gene gun and Ad5/Ad5F35-vector boost expressing HDAg conferred protection from HDV in WHV/HDV co-infection in 5 out of 7 immunized animals. The two animals with the breakthrough had a shorter HDV viremia as compared to the un-vaccinated controls (Fiedler et al., 2013) licensed Hepatitis D human vaccine Generic Unknown VO_0003059 Subunit vaccine Licensed A generic representation of vaccines used to prevent Hepatitis D virus infection in humans, which are based on the hepatitis B surface antigen (HBsAg) subunit. These vaccines induce immunity against Hepatitis D by protecting against Hepatitis B, which is required for Hepatitis D virus infection. p27 Hepatitis delta virus 226737605 CDD:279813 261991 ? Large delta antigen 10.45 26158.73 329 L-HDAg; p27 >sp|P0C6M5.1|LHDAG_HDVU2 RecName: Full=Large delta antigen; Short=L-HDAg; AltName: Full=p27; Flags: Precursor MSRSESKKNRGGREEILEQWVGARKKLEELERDLRKIKKKIKKLEEENPWLGNIKGILGKKDREGEGAPP AKRARADQMEVDSGPRKRPFRGEFTDKERRDHRRRKALENKRKQLSSGGKSLSKEEEEELRKLTEEDERR ERRVAGPRVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFARTGEGLDVRGNQGFPWDILFPADPPFSPQS CRPQ Protective antigen A.D.A.M. Medical Encyclopedia website 2012 http://www.ncbi.nlm.nih.gov/pubmedhealth/PMH0001264/ Fiedler et al., 2013 journal Fiedler M, Kosinska A, Schumann A, Brovko O, Walker A, Lu M, Johrden L, Mayer A, Wildner O, Roggendorf M 2013 Journal of virology