Parainfluenza virus 31605 Human parainfluenza viruses (HPIVs) commonly cause upper and lower respiratory illnesses in infants and young children. But, anyone can get respiratory illness from HPIV. Symptoms of upper respiratory illness may include fever, runny nose, and cough. HPIVs can cause more severe lower respiratory illness, such as croup or pneumonia. Young children are more likely to have these severe illnesses. But, older adults and people with weakened immune systems are also at risk. You can have multiple HPIV illnesses in your lifetime. HPIVs spread from person to person through close personal contact, in the air by coughing and sneezing, and by touching objects or surfaces that have HPIVs on them. People usually get infected with HPIV in the spring, summer, and fall (CDC - Human Parainfluenza Viruses). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 licensed Parainfluenza virus infection human vaccine Generic Unknown VO_0000749 Live, attenuated vaccine Licensed A generic representation of vaccines utilized to prevent Parainfluenza virus infection in humans, most commonly based on live, attenuated virus formulations. These vaccines aim to induce protective immunity by mimicking natural infection without causing disease. MEDI-534 Live, attenuated vaccine Research intranasal immunization MEDI-534 is a live, attenuated, intranasal vaccine against RSV and PIV3. It is a chimeric bovine/human (b/h) PIV3 construct that expresses the hPIV3 fusion (F), the hPIV3 hemagglutinin-neuraminidase, and the RSV F proteins from a bPIV3 viral genome. (Gomez et al., 2009) Vaccine virus was recovered from Vero cells using plasmid rescue procedure and was further expanded in Vero cells as previously described by Tang et al. AccuSpray sprayers were filled with a 0.2 mL single intranasal dose of MEDI-534 containing 10^4, 10^5, or 10^6 median tissue culture infectious dose (Gomez et al., 2009) intranasal immunization Recombinant protein preparation Expresses the hPIV3 fusion (F) protein (Gomez et al., 2009) Recombinant protein preparation Expresses the hPIV3 hemagglutinin-neuraminidase (Gomez et al., 2009) Recombinant protein preparation Expresses the hPIV3 F proteins from the bPIV3 viral genome.(Gomez et al., 2009) mRNA-1653 mRNA vaccine Licensed Intramuscular injection (i.m.) The mRNA-1653 vaccine is bivalent, containing 2 distinct nucleoside-modified mRNA sequences encoding the native, membrane-anchored fusion glycoproteins of hMPV and PIV3 encapsulated in a lipid nanoparticle.(August et al., 2022) Intramuscular injection (i.m.) The sources of the encoded antigens were the hMPV A strain, TN/92-4, and the PIV3 strain, PER/FLA4815/2008. (August et al., 2022) rHPIV1 84/del170/942A Live, attenuated vaccine Research intranasal immunization rHPIV1 84/del170/942A Is a live attenuated human parainfluenza type 1 virus vaccine administered intranasally via nose drops.(Makula et al., 1978) One immunization of 1x10^6 TCID50 rHPIV1 84/del170/942A administered intranasally via nose drops at study entry (Makula et al., 1978) intranasal immunization rHPIV3cp45 Vaccine Charles River Laboratories Live recombinant vaccine Licensed Intramuscular injection (i.m.) The experimental vaccine rHPIV3cp45 is a live recombinant (r)-derived attenuated human (H) PIV3 virus Serum specimens were stored frozen until use.(Englund et al., 2013) Vaccine virus was stored frozen at −70 °C and had a mean infectivity titer of 107 tissue culture infectious doses (TCID50) per mL. Final vial content was diluted to dose on-site. (Englund et al., 2013) Intramuscular injection (i.m.) HN Parainfluenza virus AAL89408 CDD:278832 188538 HN glycoprotein 7.97 62004.5 666 Haemagglutinin-neuraminidase; pfam00423 >AAL89408.1 HN glycoprotein [Human parainfluenza virus 1 strain Washington/1964] MAEKGKTNSSYWSTTRNDNSTVNTHINTPAGRTHIWLLIATTMHTVLSFIIMILCIDLIIKQDTCMKTNI MTVSSMNESAKIIKETITELIRQEVISRTINIQSSVQSGIPILLNKQSRDLTQLIEKSCNRQELAQICEN TIAIHHADGISPLDPHDFWRCPVGEPLLSNNPNISLLPGPSLLSGSTTISGCVRLPSLSIGDAIYAYSSN LITQGCADIGKSYQVLQLGYISLNSDMYPDLNPVISHTYDINDNRKSCSVIAAGTRGYQLCSLPTVNETT DYSSEGIEDLVFDILDLKGKTKSHRYKNEDITFDHPFSAMYPSVGSGIKIENTLIFLGYGGLTTPLQGDT KCVINRCTNVNQSVCNDALKITWLKKRQVVNVLIRINNYLSDRPKIVVETIPITQNYLGAEGRLLKLGKK IYIYTRSSGWHSNLQIGSLDINNPMTIKWAPHEVLSRPGNQDCNWYNRCPRECISGVYTDAYPLSPDAVN VATTTLYANTSRVNPTIMYSNTSEIINMLRLKNVQLEAAYTTTSCITHFGKGYCFHIVEINQASLNTLQP MLFKTSIPKICKITS Protective antigen [Ref5018:Kobayashi et al., 2013] CDC - Human Parainfluenza Viruses website http://www.cdc.gov/parainfluenza/about/overview.html Kobayashi et al., 2013 journal Kobayashi H, Iwatsuki-Horimoto K, Kiso M, Uraki R, Ichiko Y, Takimoto T, Kawaoka Y 2013 31 52 6239-6246 Vaccine