Human metapneumovirus 162145 Respiratory tract infection Human metapneumovirus is a negative single-stranded RNA virus belonging to the Paramyxoviridae family. Compared to human respiratory syncytial virus, HMPV is less severe and occurs in slightly older children. It can lead to hospitalization in children, elderly, and immunocompromised individuals (Wiki: Metapneumovirus). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Human metapneumovirus G protein mutant vaccine VO_0002976 Live, attenuated vaccine Research intranasal immunization intranasal immunization Gene mutation This G protein is from Human metapneumovirus (Biacchesi et al., 2005). A G protein mutant is attenuated in African green monkeys (Biacchesi et al., 2005). A G protein mutant induces significant protection in African green monkeys from challenge with wild type HMPV (Biacchesi et al., 2005). Human metapneumovirus HMPV-VLP F/GC-85473 Viral-like particles-based vaccine Research Intraperitoneal injection (i.p.) Retroviral-based VLPs (virus like particles) displaying HMPV glycoproteins induced protection against homologous and heterologous HMPV challenge. (Lévy et al., 2013) Intraperitoneal injection (i.p.) Retroviral-based VLP F/GC-85473 displaying HMPV glycoproteins (Lévy et al., 2013) Retroviral-derived VLPs incorporating F alone or in combination with G induced neutralizing antibody responses in mice. Maximal levels of neutralization could be reached after 2 consecutive injections. (Lévy et al., 2013) Groups of 4–6-week-old BALB/c mice (Charles River Laboratories) were immunized by intraperitoneal injection with 100 µl of concentrated HMPV-VLPs incorporating FC-85473 , F/GC-85473 , FCan98-75, or no GP or with PBS. (Lévy et al., 2013) Infection by the Can98-75 strain led to 100% mortality by day 8 after challenge in control mice inoculated with PBS as well as with NoEnv-VLPs. In contrast, mice previously infected with the homologous virus, Can98-75, recovered and survived the challenge. Similarly, most mice immunized with HMPV-VLPs survived the challenge, indicating a cross-protection induced by immunization by VLPs harboring non-homologous F or F/G glycoproteins. Challenge with the C-85473 strain of HMPV was sub-lethal due to a slightly lower inoculum than that of Can98-75 virus, since mice immunized with PBS only or with NoEnv-VLPs exhibited profound weight loss yet with 67% survival by day 8 post-challenge. In contrast, mice previously immunized with the homologous virus, C-85473, or with homologous or het- erologous HMPV-VLPs exhibited partial weight loss and survived the challenge. (Lévy et al., 2013) Mice were immunized with VLPs as described above or were infected intranasally with 0.8 × 10^6 TCID50 of either C-85473 or Can98-75 at each time. Twenty-one days after the last immunization, mice were infected intranasally with HMPV strain C-85473 (8 × 10^5 TCID50 /mouse) or Can98-75 (1 × 10^6 TCID50 ) (Lévy et al., 2013) Human metapneumovirus HMPV-VLP FC-85473 Viral-like particles-based vaccine Research Intraperitoneal injection (i.p.) Retroviral-based VLPs (virus like particles) displaying HMPV glycoproteins induced protection against homologous and heterologous HMPV challenge. (Lévy et al., 2013) Intraperitoneal injection (i.p.) Retroviral-based VLP FC-85473 displaying HMPV glycoproteins (Lévy et al., 2013) Retroviral-derived VLPs incorporating F alone or in combination with G induced neutralizing antibody responses in mice. Maximal levels of neutralization could be reached after 2 consecutive injections. (Lévy et al., 2013) Groups of 4–6-week-old BALB/c mice (Charles River Laboratories) were immunized by intraperitoneal injection with 100 µl of concentrated HMPV-VLPs incorporating FC-85473 , F/GC-85473 , FCan98-75, or no GP or with PBS. (Lévy et al., 2013) Infection by the Can98-75 strain led to 100% mortality by day 8 after challenge in control mice inoculated with PBS as well as with NoEnv-VLPs. In contrast, mice previously infected with the homologous virus, Can98-75, recovered and survived the challenge. Similarly, most mice immunized with HMPV-VLPs survived the challenge, indicating a cross-protection induced by immunization by VLPs harboring non-homologous F or F/G glycoproteins. Challenge with the C-85473 strain of HMPV was sub-lethal due to a slightly lower inoculum than that of Can98-75 virus, since mice immunized with PBS only or with NoEnv-VLPs exhibited profound weight loss yet with 67% survival by day 8 post-challenge. In contrast, mice previously immunized with the homologous virus, C-85473, or with homologous or het- erologous HMPV-VLPs exhibited partial weight loss and survived the challenge. (Lévy et al., 2013) Mice were immunized with VLPs as described above or were infected intranasally with 0.8 × 10^6 TCID50 of either C-85473 or Can98-75 at each time. Twenty-one days after the last immunization, mice were infected intranasally with HMPV strain C-85473 (8 × 10^5 TCID50 /mouse) or Can98-75 (1 × 10^6 TCID50 ) (Lévy et al., 2013) Human metapneumovirus HMPV-VLP FCan98-75 Viral-like particles-based vaccine Research Intraperitoneal injection (i.p.) Retroviral-based VLPs (virus like particles) displaying HMPV glycoproteins induced protection against homologous and heterologous HMPV challenge. (Lévy et al., 2013) Intraperitoneal injection (i.p.) Retroviral-based VLP FCan98-75 displaying HMPV glycoproteins (Lévy et al., 2013) Retroviral-derived VLPs incorporating F alone or in combination with G induced neutralizing antibody responses in mice. Maximal levels of neutralization could be reached after 2 consecutive injections. (Lévy et al., 2013) Groups of 4–6-week-old BALB/c mice (Charles River Laboratories) were immunized by intraperitoneal injection with 100 µl of concentrated HMPV-VLPs incorporating FC-85473 , F/GC-85473 , FCan98-75, or no GP or with PBS. (Lévy et al., 2013) Infection by the Can98-75 strain led to 100% mortality by day 8 after challenge in control mice inoculated with PBS as well as with NoEnv-VLPs. In contrast, mice previously infected with the homologous virus, Can98-75, recovered and survived the challenge. Similarly, most mice immunized with HMPV-VLPs survived the challenge, indicating a cross-protection induced by immunization by VLPs harboring non-homologous F or F/G glycoproteins. Challenge with the C-85473 strain of HMPV was sub-lethal due to a slightly lower inoculum than that of Can98-75 virus, since mice immunized with PBS only or with NoEnv-VLPs exhibited profound weight loss yet with 67% survival by day 8 post-challenge. In contrast, mice previously immunized with the homologous virus, C-85473, or with homologous or het- erologous HMPV-VLPs exhibited partial weight loss and survived the challenge. (Lévy et al., 2013) Mice were immunized with VLPs as described above or were infected intranasally with 0.8 × 10^6 TCID50 of either C-85473 or Can98-75 at each time. Twenty-one days after the last immunization, mice were infected intranasally with HMPV strain C-85473 (8 × 10^5 TCID50 /mouse) or Can98-75 (1 × 10^6 TCID50 ) (Lévy et al., 2013) Human metapneumovirus M2-2 mutant vaccine VO_0002977 Live, attenuated vaccine Research intranasal immunization intranasal immunization Gene mutation This M2-2 mutant is from Human metapneumovirus (Biacchesi et al., 2005). An M2-2 mutant is attenuated in African green monkeys (Biacchesi et al., 2005). An M2-2 mutant induces significant protection in African green monkeys from challenge with wild type HMPV (Biacchesi et al., 2005). licensed Human metapneumovirus infection human vaccine Generic Unknown VO_0002511 Inactivated or "killed" vaccine Licensed A generic representation of vaccines utilized to prevent human metapneumovirus infection, typically employing inactivated virus particles to elicit protective immunity against respiratory tract infections. G protein Human metapneumovirus CAN97-83 75549950 CDD:118131 694067 ? Major surface glycoprotein G 219 Attachment glycoprotein G; Membrane-bound glycoprotein; mG >gi|75549950|sp|Q6WB94.1|VGLG_HMPVC RecName: Full=Major surface glycoprotein G; AltName: Full=Attachment glycoprotein G; AltName: Full=Membrane-bound glycoprotein; Short=mG MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSSESEHHTSSPP TESNKEASTISTDNPDINPNSQHPTQQSTENPTLNPAASVSPSETEPASTPDTTNRLSSVDRSTAQPSES RTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMSSTGKRPTTTSVQSDSSTTTQNHEETGSANP QASVSTMQN Virmugen A G mutant is attenuated in African green monkeys and induces protection from challenge with wild type HMPV [Ref1997:Biacchesi et al., 2005]. M2-2 Human metapneumovirus CAN97-83 75549952 694067 ? Matrix protein M2-2 71 Matrix protein M2-2. /FTId=PRO_0000394813. >gi|75549952|sp|Q6WB96.1|M22_HMPVC RecName: Full=Matrix protein M2-2 MTLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYL S Virmugen An M2-2 mutant is attenuated in African green monkeys and induced protection from challenge with wild type HMPV [Ref1997:Biacchesi et al., 2005]. Aerts et al., 2015 journal Aerts L, Rhéaume C, Carbonneau J, Lavigne S, Couture C, Hamelin MÈ, Boivin G 2015 96 Pt 4 767-774 The Journal of general virology Biacchesi et al., 2005 journal Biacchesi S, Pham QN, Skiadopoulos MH, Murphy BR, Collins PL, Buchholz UJ 2005 79 19 12608-12613 Journal of virology Más et al., 2016 journal Más V, Rodriguez L, Olmedillas E, Cano O, Palomo C, Terrón MC, Luque D, Melero JA, McLellan JS 2016 12 9 e1005859 PLoS pathogens O'Shaughnessy et al., 2011 journal O'Shaughnessy L, Carr M, Crowley B, Carberry S, Doyle S 2011 52 3 236-243 Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology Wiki: Metapneumovirus website http://en.wikipedia.org/wiki/Metapneumovirus