Edwardsiella tarda 636 E. tarda is typically found in the normal gut flora of fish and humans, and can be an opportunistic pathogen in human, causing gastroenteritis and diarrhea. E. tarda has a high affinity for red blood cells due to specific fimbriae that it produces (Microbe Wiki: E. tarda). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 BL21(DE3)/pUTa-E + pET28a-FT VO_0004804 Recombinant vector vaccine Research Intramuscular injection (i.m.) Cell-penetrating peptides (CPPs) are short cationic/amphipathic peptides which facilitate cellular uptake of various molecular cargoes and therefore have great potentials in vector vaccine design. Among the tested CPPs, TAT showed an excellent capability to deliver the cargo protein EGFP into cytoplasm (Ma et al., 2014). In order to establish an efficient antigen delivery system in Escherichia coli, the EGFP-TAT synthesis circuit was combined with an in vivo inducible lysis circuit PviuA-E in E. coli to form an integrated antigen delivery system, the resultant E. coli was proved to be able to lyse upon the induction of a mimic in vivo signal and thus release intracellular EGFP-TAT intensively, which were assumed to undergo a more efficient intracellular delivery by CPP to evoke protective immune responses. Based on the established antigen delivery system, the protective antigen gene flgD from an invasive intracellular fish pathogen Edwardsiella tarda EIB202, was applied to establish an E. coli recombinant vector vaccine (Ma et al., 2014). Intramuscular injection (i.m.) VO_0000287 BL21(DE3)/pUTa-E + pET28a-FT conferred an significantly better immune protection (RPS of 63%) than the other control strains. This result suggested fused cell-penetrating peptides (CPPs) could facilitate the internalization of antigens, released by the lysed bacteria, into the immune-related cells, such as macrophage, and in turn promote a more protective immune response in host (Ma et al., 2014). E. coli-CPPs (Edwardsiella tarda) VO_0004640 Recombinant vector vaccine Research Intramuscular injection (i.m.) GFP-TAT synthesis circuit was combined with an in vivo inducible lysis circuit PviuA-E in E. coli to form an integrated antigen delivery system (Ma et al., 2014). Intramuscular injection (i.m.) VO_0003057 This E. coli vector vaccine presented superior immune protection under the challenge with E. tarda EIB202, suggesting that the novel antigen delivery system had great potential in bacterial vector vaccine applications (Ma et al., 2014). Hosts were challenged with E. tarda EIB202 (Ma et al., 2014). E. tarda DNA vaccine pCE18 VO_0004556 DNA vaccine Research pCN3 [Ref2677:Jiao et al., 2009] Intramuscular injection (i.m.) Intramuscular injection (i.m.) FliC-Et18 fusion protein from E. tarda TX1 (Jiao et al., 2009) DNA vaccine construction DNA vaccine construction VO_0003057 Following TX1 challenge, fish immunized with pCE18, pCN3 (plasmid), and PBS exhibited cumulative mortalities of 35%, 90%, and 95%, respectively. Hence, with pCN3 as a control, the protective efficacy of pCE18 was 61% in terms of RPS (Jiao et al., 2009). E. tarda DNA vaccine pCE6 VO_0004557 DNA vaccine Research pCN3 [Ref2677:Jiao et al., 2009] Intramuscular injection (i.m.) Intramuscular injection (i.m.) FliC-Eta6 fusion protein from E. tarda TX1 (Jiao et al., 2009) DNA vaccine construction DNA vaccine construction VO_0003057 Upon exposure to TX1 challenge, the cumulative mortalities of the pCE6-, pCN3-, and PBS-vaccinated fish were 25%, 90%, and 95%, respectively. Therefore, compared to vaccination with pCN3, vaccination with pCE6 produced a RPS of 72%, which is significantly higher than that produced by pEta6 (Jiao et al., 2009). E. tarda DNA vaccine pCEsa1 VO_0004558 DNA vaccine Research pCN3 [Ref2678:Sun et al., 2011] Intramuscular injection (i.m.) Intramuscular injection (i.m.) Esa1 from E. tarda TX1 (Sun et al., 2011) DNA vaccine construction VO_0003057 The accumulated mortalities of pCEsa1-, pCN3-, and PBS-vaccinated fish were 20%, 76%, and 80%, respectively. Hence, compared to PBS-vaccinated fish, pCEsa1-vaccinated fish were significantly (P < 0.05) protected, with a RPS of 75% (Sun et al., 2011). Edwardsiella tarda aroC mutant vaccine VO_0002830 Live, attenuated vaccine Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) Gene mutation This aroC mutant is from Edwardsiella tarda (Xiao et al., 2011) An aroC mutant is attenuated in zebra fish (Xiao et al., 2011). An aroC mutant is protective in zebra fish against challenge from wild type E. tarda, resulting in a 68.3% relative percent survival (Xiao et al., 2011). Edwardsiella tarda aroC/esrC mutant vaccine VO_0002832 Live, attenuated vaccine Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) Gene mutation This aroC/esrC mutant is from Edwardsiella tarda (Xiao et al., 2011). Gene mutation This aroC/esrC mutant is from Edwardsiella tarda (Xiao et al., 2011). This aroC/esrC mutant is attenuated in zebra fish (Xiao et al., 2011). This aroC/esrC mutant is protective against challenge from wild type E. tarda, with a 71.3% relative percent survival (Xiao et al., 2011). Edwardsiella tarda aroC/slyA mutant vaccine VO_0002831 Live, attenuated vaccine Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) Gene mutation An aroC and slyA mutant is attenuated in zebra fish. This mutant is also protective against challenge from wild type E. tarda, resulting in a relative percent survival of 80.1% (Xiao et al., 2011). This aroC/slyA mutant is attenuated in zebra fish (Xiao et al., 2011). This aroC/slyA mutant is protective in zebra fish against challenge with wild type E. tarda. The percent relative survival is 80.1% (Xiao et al., 2011). Edwardsiella tarda esrB mutant vaccine VO_0002833 Live, attenuated vaccine Research Intraperitoneal injection (i.p.) Intraperitoneal injection (i.p.) Gene mutation This esrB mutant is from Edwardsiella tarda (Lan et al., 2007). A esrB mutant is attenuated in fish (Lan et al., 2007). An esrB mutant induces significant protection in fish from challenge with wild type Edwardsiella tarda (Lan et al., 2007). aroC Edwardsiella tarda EIB202 8608790 269139790 ETAE_2445 CP001135 YP_003296491 498217 2576311 2577396 - chorismate synthase 6.99 36170.26 361 >gi|269137358:2576311-2577396 Edwardsiella tarda EIB202 chromosome, complete genome TTTACCAGCGCGGTATCGTACAGGCGACATCCGCACACTGCGCACGCTGGCGCAGCAAATGATCCATCAG CACCAGCGCCATCATCGCCTCGGCGATCGGCACCGCCCGGATCCCCACGCAGGGATCGTGGCGGCCGCGG GTGACCATGGTCGTCGCCTCGCCGTCGCGGGTAATGGTCTGCCCCGGCACCATAATGCTCGACGTCGGCT TCAGCGCCAGACGCGCCAGCAGCGGCTGACCGCTGCTGATCCCGCCCAGAATGCCGCCGGCATGGTTGCT GAGAAAGCCCGTCGGGCTGATCTCGTCACGGTGCTCGCTGCCGCGCTGCCCCACCACCGCAAAGCCGTCG CCGATCTCGACGCCCTTCACCGCATTGATGCTCATCAGCGCATGGGCCACGTCGGCATCCAGGCGATCGA AGACCGGCTCGCCCAGCCCGGGGGGAACCCCGGTCGCCATCACCATCACCTCGGCGCCGATCGAGTCGCC GCTCTTTTTCAGATCGCGCATCAGGGCATCCAGCGCCGCCAGCTGCTGGACATCGGGACAGAAGAAGGGA TTCTGCTCTACCTGCGCCCAGTCATACTGACGGCAGACGATATCGCCCATCCGGCTCAGGCAGGCGCGGA TAACGATGCCATGCTGCTGCTGAAGGTATTTTTTCGCGATCGCCCCGGCGGCGACGCGCATCGCGGTCTC CCGCGCAGAGGAGCGCCCGCCGCCGCGGTAGTCGCGCAGACCATACTTCTGCTCATAGCTGTAGTCAGCG TGACCCGGACGAAACAGATCCTTGATGGCGCTATAGTCCTGCGAGCGCTGATCGGTGTTCTCGATCAGCA GTCCAATACTGGTGCCGGTGGTCACCCCCTCAAAGACACCCGACAGGATCCGCACCCGATCATCCTCTCG CCGCGCCGTGGTGTAGCGCGATGCGCCGGGGCGACGGCGATCGAGATCGTGCTGCAGATCCGCCTCGCTC AGCGCCATTCCCGGCGGAACGCCGTCCACAATGCAGCCCAGCGCCGCACCGTGTGACTCGCCGAAGGTGG TGACTCTGAATACCTGACCAATGCTGTTTCCCGCCA >gi|269139790|ref|YP_003296491.1| chorismate synthase [Edwardsiella tarda EIB202] MAGNSIGQVFRVTTFGESHGAALGCIVDGVPPGMALSEADLQHDLDRRRPGASRYTTARREDDRVRILSG VFEGVTTGTSIGLLIENTDQRSQDYSAIKDLFRPGHADYSYEQKYGLRDYRGGGRSSARETAMRVAAGAI AKKYLQQQHGIVIRACLSRMGDIVCRQYDWAQVEQNPFFCPDVQQLAALDALMRDLKKSGDSIGAEVMVM ATGVPPGLGEPVFDRLDADVAHALMSINAVKGVEIGDGFAVVGQRGSEHRDEISPTGFLSNHAGGILGGI SSGQPLLARLALKPTSSIMVPGQTITRDGEATTMVTRGRHDPCVGIRAVPIAEAMMALVLMDHLLRQRAQ CADVACTIPRW Virmugen An aroC mutant is attenuated in zebra fish. The aroC mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 68.3% [Ref2079:Xiao et al., 2011]. esa1 Edwardsiella tarda strain TX1 302136428 CDD:236834 CDD:284624 CDD:279448 636 ? putative surface antigen 5.14 82376.08 866 outer membrane protein assembly factor YaeT; Provisional >ADK94171.1 putative surface antigen [Edwardsiella tarda] MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNTIRALYATG NFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVGEALDRTTLSSIEKGLEDF YYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINIVGNHAFSSAELLGHFQLRDDVPWWNLMA DRKYQKQKLAGDLEALRSYYLDRGYARFAINSTQVSLTPDKKGIYITINITESEQYKLEGVDVTGNMAGY SAEITRLTKVEPGELYNGAKVTKMEDEIKQLLGRYGYAYPCVQTQPEINDKDKTVVLHMNIDAGNRYYVR QIRFVGNDTSKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVKE RNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFTVNGVSLGGRLF YNDFKANDADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDMQPQVAMWRYLRSVGQNPSDSQ RASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNGKITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLG RTRLGYGNGFGGKEMPFYENFYAGGSGTVRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVAS LELITPTPFVSEQYANSLRTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNVRLSAGIALQWMSPLGPLVF SYAQPVKKYEGDKAEQFQFNIGKTW Protective antigen Together these results indicate that Esa1 is a protective immunogen and an effective oral vaccine when delivered by FP3/pJsa1 as a surface-anchored antigen.[Ref4764:Sun et al., 2010] esrB Edwardsiella tarda EIB202 8607237 269138242 ETAE_0886 CP001135 YP_003294942 498217 964657 965301 - two-component response regulator EsrB, LuxR family 9.13 21902.65 214 >gi|269137358:964657-965301 Edwardsiella tarda EIB202 chromosome, complete genome ATTAAAACTCCAGAACCCCCAGGCGGCGGGCCCAGTTGCTCAGCTCCGCCGCGTTGTGGGCATCCAGCTT GCGCATCAGGTTGAGCCGGTGGGTCTCCACGGTTTTCAGGCTGATGGACAGCAGCTCCGCGATATCCCGG TTGCGCTTGCCCTCGGCGACCAGCTTGAGAATTTGCCGTTCGCGCAGGGTCAGCGGCGGCTCCTGAGCCA TATCGGACGAGGCTACCAGGGAGTCCAGCCGGAGGGCGGGATCGACAAAGGTTTTCCCCAGCGAGGCATG CTGCATGGCCGCCAGCAGGGTTTGCTGCGGGCTTTGCTTCAGGACGTAGGCGAGCGCGCCGGCGGCGAGG GCTTCGCTGCCGCGCCGTGCCTCAGAGGAGGCGGTGACGACGACGATACGCATATCGCTCCAGCGACGCC GCAGCTGACGGATCACGTCAACGCCGTCCATGCCCGGCAGACCCAGATCGAGTAAGACCAGATCGGGCGA GAGACGCTGGCAGGCCTCATAAACGGCCAGCCCATTCGAGACGGCGCCCACGACCCGGTAGCGGGGCTGG CTGTCCAAGAGATTACGGATGCCATCGGCTAGCAAGGCATGATCTTCAACGATCAGAATGTTCAGAGGCA AAATAGAAATAGTCA >gi|269138242|ref|YP_003294942.1| two-component response regulator EsrB, LuxR family [Edwardsiella tarda EIB202] MTISILPLNILIVEDHALLADGIRNLLDSQPRYRVVGAVSNGLAVYEACQRLSPDLVLLDLGLPGMDGVD VIRQLRRRWSDMRIVVVTASSEARRGSEALAAGALAYVLKQSPQQTLLAAMQHASLGKTFVDPALRLDSL VASSDMAQEPPLTLRERQILKLVAEGKRNRDIAELLSISLKTVETHRLNLMRKLDAHNAAELSNWARRLG VLEF Virmugen An esrB mutant is highly attenuated in fish (turbot), with an LD50 of 10(8.1)cfu/fish. Vaccination with this mutant elicited significant protection from wild type E. tarda [Ref1995:Lan et al., 2007]. esrC Edwardsiella tarda EIB202 8607212 269138217 ETAE_0861 CP001135 YP_003294917 498217 942933 943625 - putative transcriptional regulator EsrC 9.57 25155.32 230 >gi|269137358:942933-943625 Edwardsiella tarda EIB202 chromosome, complete genome TTTAGCCGGCGCGGTGGTGAAGGCTGGCCCGACGCACTTCGCTCGGTGACTGACTAAAGTGACGCCGAAA GCAGTCAGAGAAGTGGGCGGCGTTACAGAATCCGGACTCCAGCGCGACGTCGATCACCTTTTTAGAGGTG GTTTCGAGTAGCTGGCGGGCATGGCCCAGACGCTGGCGCAGTAGCCAGCGTTTCGGCGCCATGCCGAACT TGTCGTTGAACAGCTGGTTGAACTTACGCTGCGACAGGCCGAAGAGATCGGCGTAGCGCGCGACCGGCCA GGGTTCGAGCCGATGGCGGTAGAGCGTGTCGAACAGGTCGGCATCGGCGGTTAACAGCGATCGCAGCAGG GTGGAGGTCCGTTGACACTCCAGGGTCAGGCTGTAGGCCAAGACCAGCCTGAGCATGGTTTCATCGTCGG CATCCGCGAGCCGCAGCAGCGTTTTCAGCAGGCCCGGCGCCATGGCGATGGGGAGCGGCTGAGGGGGCGC GACGGGGGCCGGGCCGCTGTACATCAGGTGCTGCAAATCGCGGCATATGCCGTGCAGCAGATTACACGGA TAGCTAAATAGCCGAGTATGCCGGGTCGACGCGATGCCGGGAGGACGCGAGTCAGCGATCAGCAGCGCGC CGGGCTCCGGCAGGAGCGCGATGTTGTCTGGACCGGTGACGAGCAGTAGATGCAAATTGGGCA >gi|269138217|ref|YP_003294917.1| putative transcriptional regulator EsrC [Edwardsiella tarda EIB202] MPNLHLLLVTGPDNIALLPEPGALLIADSRPPGIASTRHTRLFSYPCNLLHGICRDLQHLMYSGPAPVAP PQPLPIAMAPGLLKTLLRLADADDETMLRLVLAYSLTLECQRTSTLLRSLLTADADLFDTLYRHRLEPWP VARYADLFGLSQRKFNQLFNDKFGMAPKRWLLRQRLGHARQLLETTSKKVIDVALESGFCNAAHFSDCFR RHFSQSPSEVRRASLHHRAG Virmugen An aroC and esrC mutant is attenuated in zebra fish. This mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 71.3% [Ref2079:Xiao et al., 2011]. et18 Edwardsiella tarda 74474893 CDD:182907 636 ? antigenic protein Et 18 9.61 18746.93 257 outer membrane lipoprotein; Provisional >BAE44431.1 antigenic protein Et 18 [Edwardsiella tarda] MTMRFPLTRCFPALVVLSALLLQGCVAAVIGSATMATQAASDPRSVGTQVDDGTLEARISNALSKDAQLK KEARVVVTAYQGQVLLTGQAPSQALISRAKQIAMGVEGTKAVYNEIRLGQPVSLGTASADAWITTKVRSQ LLASDQVKSTNVKVTTENGEVFLLGLVTPKEGQAAAQTASKVSGVKHVTTAFSLLK Protective antigen eta6 Edwardsiella tarda strain TX1 262223754 CDD:320798 CDD:153074 636 ? hypothetical protein Eta6 8.03 17712.21 230 Protease Inhibitor Ecotin; homodimeric protease inhibitor; cl00178 >ACY38270.1 hypothetical protein Eta6 [Edwardsiella tarda] MKTFSMMMAGMMLAASSVSAWAGSADLSRQPLDKVAPYPQAEQGMTRQVIYLPPRDDEAALRVELLIGKT LQVDCNRQRLMGQLESKTLQGWGYDYLVMDKVSGPMGTLMACPDNQRHPAFVTVHLGDSALQRYNSKLPL VVYVPQGVQVKYRIWQAQPAVMDAQIK Protective antigen fliC Edwardsiella tarda strain TX1 262223752 CDD:235867 CDD:279061 CDD:279090 636 ? flagellin 4.71 41122.32 467 flagellin; Validated >ACY38269.1 flagellin [Edwardsiella tarda] MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANINGLTQASRNAND GISLAQATEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLQSIQDEITQRLSEIDRISQQTDFNGVKVLSK DQKLTIQVGANDGETIDIDLKNINAQSLGLDKFNVADSVDTTKVAAAAATKVNGPMVNIDTNGKDAGGKA ITGYVKDDKGDVYGAYDDAGTTKYAKATIGDDGKVTAFDTASATPSGTTNAVSQVTSKVAPKGADAANVY AYTGTEKGASAYVIKEGTGADAKYFKASVAEDGTVTKGSALSTTAKTADPLATLDKALSQVDDLRSGLGA VQNRFDSVINNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQSTQNVLSLLR Protective antigen slyA Edwardsiella tarda EIB202 8608031 269139033 ETAE_1684 CP001135 YP_003295734 498217 1791955 1792332 + transcriptional regulator 6.52 13582.65 125 >gi|269137358:1791955-1792332 Edwardsiella tarda EIB202 chromosome, complete genome CTTGATCGATCAGCGACTGAAGCCGCTGGAGCTGACGCAGACGCATTGGGTGACGCTGTATAACATTCAC CGCCTGCCGCCGGAGCAGTCACAGATTCAGCTGGCCAAGGCGATTGGCATTGAGCAGCCGTCGCTGGTGC GTACGCTGGATCAGCTGGAAGATAAGGGTCTGATTACTCGACATATCTGTGCTAACGATCGCCGTGCCAA ACGCATTAAGCTGACGGACGGTGCCGAACCCGTGATTAGGGAAGTGACCGACGTGATTTCGCTGACGCGC AGTGAAATCCTGGACGGTATCTCAGCGGATGAGGTCTCGCTGTTGACCAGTCTGGTCGAACGTCTGGAGC AGAACATTATTCATTTACAGAATAAATA >gi|269139033|ref|YP_003295734.1| transcriptional regulator [Edwardsiella tarda EIB202] MIDQRLKPLELTQTHWVTLYNIHRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEDKGLITRHICANDRRAK RIKLTDGAEPVIREVTDVISLTRSEILDGISADEVSLLTSLVERLEQNIIHLQNK Virmugen An aroC and slyA mutant is attenuated in zebra fish. This mutant is also protective against challenge from wild type E. tarda, resulting in a relative percent survival of 80.1% [Ref2079:Xiao et al., 2011]. Beck et al., 2017 journal Beck BR, Lee SH, Kim D, Park JH, Lee HK, Kwon SS, Lee KH, Lee JI, Song SK 2017 68 19-28 Fish & shellfish immunology Hu et al., 2012 journal Hu YH, Dang W, Deng T, Sun L 2012 32 4 616-620 Fish & shellfish immunology Jiao et al., 2009 journal Jiao XD, Dang W, Hu YH, Sun L 2009 27 5 633-638 Fish & shellfish immunology Jiao et al., 2009 journal Jiao XD, Zhang M, Hu YH, Sun L 2009 27 38 5195-5202 Vaccine Jiao et al., 2010 journal Jiao XD, Hu YH, Sun L 2010 28 34 5635-5640 Vaccine Jiao et al., 2010 journal Jiao XD, Zhang M, Cheng S, Sun L 2010 28 4 672-677 Fish & shellfish immunology Jin et al., 2012 journal Jin RP, Hu YH, Sun BG, Zhang XH, Sun L 2012 33 3 514-521 Fish & shellfish immunology Lan et al., 2007 journal Lan MZ, Peng X, Xiang MY, Xia ZY, Bo W, Jie L, Li XY, Jun ZP 2007 23 3 521-530 Fish & shellfish immunology Li et al., 2012 journal Li MF, Hu YH, Zheng WJ, Sun BG, Wang CL, Sun L 2012 32 4 586-592 Fish & shellfish immunology Liu et al., 2016 journal Liu F, Tang X, Sheng X, Xing J, Zhan W 2016 79 55-65 Molecular immunology Liu et al., 2017 journal Liu F, Tang X, Sheng X, Xing J, Zhan W 2017 185 38-47 Veterinary immunology and immunopathology Liu et al., 2017 journal Liu F, Tang X, Sheng X, Xing J, Zhan W 2017 104 238-247 Microbial pathogenesis Ma et al., 2014 journal Ma J, Xu J, Guan L, Hu T, Liu Q, Xiao J, Zhang Y 2014 39 1 8-16 Fish & shellfish immunology Microbe Wiki: E. tarda website http://microbewiki.kenyon.edu/index.php/Edwardsiella_tarda Song et al., 2013 journal Song M, Xie J, Peng X, Li H 2013 35 6 1932-1936 Fish & shellfish immunology Sun et al., 2010 journal Sun Y, Liu CS, Sun L 2010 28 40 6603-6608 Vaccine Sun et al., 2011 journal Sun Y, Liu CS, Sun L 2011 30 1 273-279 Fish & shellfish immunology Sun et al., 2012 journal Sun Y, Zheng WJ, Hu YH, Sun BG, Sun L 2012 80 8 2948-2955 Infection and immunity Trung et al., 2014 journal Trung Cao T, Tsai MA, Yang CD, Wang PC, Kuo TY, Gabriel Chen HC, Chen SC 2014 60 6 241-250 The Journal of general and applied microbiology Wang et al., 2010 journal Wang B, Mo ZL, Xiao P, Li J, Zou YX, Hao B, Li GY 2010 12 6 678-685 Marine biotechnology (New York, N.Y.) Wang et al., 2013 journal Wang C, Hu YH, Chi H, Sun L 2013 35 3 858-865 Fish & shellfish immunology Xiao et al., 2011 journal Xiao J, Chen T, Wang Q, Liu Q, Wang X, Lv Y, Wu H, Zhang Y 2011 Letters in applied microbiology