Infectious Bursal Disease Virus (IBDV) 10995 The virus is attracted to lymphoid cells and especially those of B-lyphocyte origins. Young birds at around two to eight weeks of age that have highly active bursa of Fabricius are more susceptible to disease. Birds over eight weeks are resistant to challenge and will not show clinical signs unless infected by highly virulent strains. After ingestion, the virus destroys the lymphoid follicles in the bursa of Fabricius as well as the circulating B-cells in the secondary lymphoid tissues such as GALT (gut-associated lymphoid tissue), CALT (conjunctiva), BALT (Bronchial) cecal tonsils, Harderian gland, etc. Acute disease and death is due to the necrotizing effect of these viruses on the host tissue. If the bird survives and recovers from this phase of the disease, they remain immunocompromised which means they are more susceptible to other diseases and vaccination in the face of outbreak will not be effective (Wiki: Infectious Bursal Disease). Infectious Bursal Disease Passive immunity protects against disease, as does previous infection with avirulent strains. In broiler farms, breeder flocks are immunized against IBD so that they would confer protective antibodies to their progenies which would be slaughtered for consumption before their passive immunity wears out (Wiki: Infectious Bursal Disease). Chickens Infectious bursal disease (IBD) is a highly contagious disease of young chickens caused by infectious bursal disease virus (IBDV), characterized by immunosuppression and mortality generally at 3 to 6 weeks of age. It is economically important to the poultry industry worldwide due to increased susceptibility to other diseases and negative interference with effective vaccination. In recent years, very virulent strains of IBDV (vvIBDV), causing severe mortality in chicken, have emerged in Europe, Latin America, South-East Asia, Africa and the Middle East. Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Bursal Disease Killed Virus Vaccine (USDA: 1275.00) Wyeth VO_0001632 Inactivated or "killed" vaccine Licensed USA Bursal Disease Killed Virus Vaccine (USDA: 1275.02) Lohmann Animal Health International VO_0001633 Inactivated or "killed" vaccine Licensed USA Bursal Disease Killed Virus Vaccine (USDA: 1275.20) Intervet Inc. VO_0001634 Inactivated or "killed" vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.00) Wyeth, Intervet Inc., Lohmann Animal Health International, Merial, Inc. VO_0001635 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.01) Biomune Company VO_0001636 Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.02) Lohmann Animal Health International VO_0001637 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.04) Biomune Company VO_0001638 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.0A) Merial, Inc. VO_0001639 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.10) Wyeth, Merial, Inc. VO_0001640 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.11) Intervet Inc., Lohmann Animal Health International VO_0001641 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.12) Intervet Inc., Merial, Inc. VO_0001642 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.13) Merial, Inc. VO_0001643 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.16) Intervet Inc. VO_0001644 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.17) Intervet Inc. VO_0001645 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.18) Intervet Inc. VO_0001646 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.19) Intervet Inc. VO_0001647 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.40) Intervet Inc. VO_0001648 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1271.41) Intervet Inc. VO_0001649 Live vaccine Licensed USA Bursal Disease Live Virus Vaccine (USDA: 1272.00) Lohmann Animal Health International VO_0001650 Live vaccine Licensed USA Bursal Disease Modified Live VirusVaccine (USDA: 1271.15) Wyeth VO_0001651 Live, attenuated vaccine Licensed USA Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.01) Lohmann Animal Health International VO_0001652 Inactivated or "killed" vaccine Licensed USA Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.40) Merial, Inc., Biomune Company VO_0001653 Inactivated or "killed" vaccine Licensed USA Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.41) Intervet Inc., Biomune Company VO_0001654 Inactivated or "killed" vaccine Licensed USA Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.4A) Lohmann Animal Health International VO_0001655 Inactivated or "killed" vaccine Licensed USA Bursal Disease Standard & Variant, Live Virus Vaccine (USDA: 12B1.00) Intervet Inc., Merial, Inc. VO_0001656 Live vaccine Licensed USA Bursal Disease Standard & Variant, Live Virus Vaccine (USDA: 12B1.01) Merial, Inc. VO_0001657 Live vaccine Licensed USA Bursal Disease Variant, Killed Virus Vaccine (USDA: 12A5.00) Intervet Inc. VO_0001658 Inactivated or "killed" vaccine Licensed USA Bursal Disease Variant, Live Virus Vaccine (USDA: 12L1.00) Intervet Inc. VO_0001659 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 1A88.R0) Merial, Inc., Biomune Company VO_0002197 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.42) Merial, Inc. VO_0002043 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.4A) Merial, Inc. VO_0002047 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1A82.50) Wyeth VO_0002196 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0) Biomune Company VO_0002040 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0) Biomune Company VO_0002040 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R1) Biomune Company VO_0002041 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.43) Merial, Inc. VO_0002044 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.44) Merial, Inc. VO_0002045 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.45) Merial, Inc. VO_0002046 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1B82.50) Wyeth VO_0002200 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R1) Biomune Company VO_0002198 Live vaccine Licensed USA Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R2) Merial, Inc. VO_0002199 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.40) Merial, Inc. VO_0002051 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.43) Merial, Inc. VO_0002053 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.42) Merial, Inc. VO_0002052 Live vaccine Licensed USA Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.44) Merial, Inc. VO_0002054 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant Strain, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.52) Intervet Inc. VO_0002050 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotype 3, Live Virus Vaccine (USDA: 1282.50) Intervet Inc. VO_0002042 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: ) Intervet Inc. VO_0002031 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.50) Intervet Inc. VO_0002048 Live vaccine Licensed USA Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.51) Intervet Inc. VO_0002049 Live vaccine Licensed USA Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.10) Wyeth VO_0002065 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.11) Intervet Inc. VO_0002066 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.43) Lohmann Animal Health International, Biomune Company VO_0002068 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease Standard & Variant, Killed Virus Vaccine (USDA: 12G5.42) Intervet Inc., Biomune Company VO_0002067 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.4M) Merial, Inc. VO_0002069 Live vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.67) Merial, Inc. VO_0002070 Live vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.40) Wyeth VO_0002071 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.43) Lohmann Animal Health International VO_0002072 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.62) Biomune Company VO_0002074 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12D5.45) Lohmann Animal Health International, Merial, Inc. VO_0002060 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12J5.61) Intervet Inc., Biomune Company VO_0002073 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00) Lohmann Animal Health International, Biomune Company VO_0002075 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01) Intervet Inc., Lohmann Animal Health International, Biomune Company VO_0002076 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40) Wyeth VO_0002078 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11) Intervet Inc. VO_0002077 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43) Lohmann Animal Health International VO_0002081 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50) Biomune Company VO_0002082 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90) Wyeth, Lohmann Animal Health International VO_0002083 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91) Wyeth, Lohmann Animal Health International VO_0002084 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41) Lohmann Animal Health International, Merial, Inc. VO_0002079 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42) Lohmann Animal Health International VO_0002080 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0) Biomune Company VO_0002085 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.40) Merial, Inc. VO_0002086 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.41) Intervet Inc., Biomune Company VO_0002087 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.E0) Biomune Company VO_0002088 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Killed Virus Vaccine (USDA: 12D5.02) Biomune Company VO_0002056 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.01) Merial, Inc., Biomune Company VO_0002055 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.03) Lohmann Animal Health International VO_0002057 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.04) Lohmann Animal Health International VO_0002058 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.30) Intervet Inc. VO_0002059 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.E0) Biomune Company VO_0002061 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F0) Intervet Inc. VO_0002062 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F1) Intervet Inc. VO_0002063 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.T0) Wyeth VO_0002064 Inactivated or "killed" vaccine Licensed USA BV-Dual-S1 VO_0004652 Recombinant vector vaccine Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) fp-IBD1 VO_0004622 Recombinant vector vaccine Licensed Intramuscular injection (i.m.) Intramuscular injection (i.m.) FP-IBDV-VP2 VO_0004742 Recombinant vector vaccine Research Intramuscular injection (i.m.) (Butter et al., 2013) fp-IBD1, which consists of a fowlpox virus vector carrying the VP2 gene of infectious bursal disease virus (IBDV) fused with β-galactosidase. Intramuscular injection (i.m.) Recombinant vector construction A fowlpox virus vector was used to carry the VP2 gene of infectious bursal disease virus (IBDV) fused with β-galactosidase (Butter et al., 2013). IBDV DNA vaccine pCAGoptiVP2/rVP2 VO_0004533 DNA vaccine Research pCAGGS prime, rVP2 protein boost [Ref2651:Gao et al., 2013] Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction The synthetic gene for VP2 protein of vvIBDV Gx with codons optimized for chicken usage was synthesized and cloned into pCAGGS vector (Gao et al., 2013). Chickens in the DNA prime–protein boost group developed significantly higher levels of ELISA and neutralizing antibodies to IBDV compared with those immunized with either the DNA vaccine or the protein vaccine alone (P < 0.05). Furthermore, the highest levels of lymphocyte proliferation response, IL-4 and IFN-γ production were induced following priming with the DNA vaccine and boosting with the rVP2 protein (Gao et al., 2013). Chickens inoculated with the DNA prime–protein boost vaccine had 100% protection against challenge with vvIBDV, as evidenced by the absence of clinical signs, mortality, and bursal atrophy. In contrast, chickens receiving the DNA vaccine and the rVP2 protein vaccine had 67% and 80% protection, respectively (Gao et al., 2013). IBDV DNA vaccine pCAGVP243-IL-18 VO_0004534 DNA vaccine Research pCAGGS [Ref2652:Li et al., 2013] Intramuscular injection (i.m.) IL-18 (Li et al., 2013) Intramuscular injection (i.m.) VP243 gene of vvIBDV HLJ0504 (VP243 can be cleaved into VP2, VP3, and VP4) (Li et al., 2013) DNA vaccine construction Chickens immunized with plasmid pCAGVP243-IL-18 carrying both VP243 and IL-18 genes induced significantly higher levels of antibodies, lymphocyte proliferation responses and of the cytokines IL-4 and IFN-γ than those injected with pCAGVP243 encoding the VP243 gene alone (Li et al., 2013). Furthermore, pCAGVP243-IL-18 provided higher protection (93%) against vvIBDV challenge in chickens than pCAGVP243 (60%), as evidenced by the absence of clinical signs, mortality, and bursal atrophy (Li et al., 2013). Infectious Bursal Disease Virus DNA Vaccine expressing VP2 VO_0004585 DNA vaccine Research pIRES [Ref2718:Kumar et al., 2009] Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction Birds immunized with pibdVP2-IRES-chiIL-2 plasmid at 21 days post-challenge showed the highest antibody titer. In addition, blood analysis showed a proliferation of CD4-positive cells in the group vaccinated with pibdVP2-IRES-chiIL-2 (Kumar et al., 2009). The birds were immunized intramuscularly with 50 μg plasmid DNA in the quadricep muscle of the hind limb (Kumar et al., 2009). VO_0003057 Birds vaccinated with the pibdVP2-IRES-chiIL-2 plasmid showed an 80% protection efficacy (Kumar et al., 2009). All vaccinated birds and the unvaccinated control birds were challenged with 10^5 ELD50 (50% embryo lethal dose) virulent IBDV (strain KT1/99) through the intrabursal and intraocular routes at 21 days post-immunization (Kumar et al., 2009). rFPV-IBDV-VP 2.4.3 VO_0004750 Recombinant vector vaccine Research Intramuscular injection (i.m.) Recombinant FPV-VP 2.4.3 contained the gene for the VP 2-VP4-VP3 polyprotein under the control of the vaccinia virus late promoter P.L 11 inserted within the thymidine kinase (TK) gene of FPV (Heine and Boyle, 1993). Intramuscular injection (i.m.) Recombinant vector construction Recombinant FPV-VP 2.4.3 contained the gene for the VP 2-VP4-VP3 polyprotein under the control of the vaccinia virus late promoter P.L 11 inserted within the thymidine kinase (TK) gene of FPV (Heine and Boyle, 1993). Vaccination with FPV-VP2 (Heine and Boyle, 1993). VO_0003057 A significant level of protection was provided by FPV-VP2 vaccination, although the level was lower than the protection provided by an oil adjuvanted inactivated whole IBDV vaccine. Birds vaccinated with FPV-VP2.4.3 were not protected from infection as assessed by ELISA for the presence of IBD virus in bursae (Heine and Boyle, 1993). The birds were challenged with IBDV (strain 002-73) (Heine and Boyle, 1993). rFPV-IBDV-VP2 VO_0004625 Recombinant vector vaccine Research Intramuscular injection (i.m.) Marek's disease and Fowlpox viruses expressing the vvIBDV host-protective antigen VP2 (rMDV, rFPV) (Tsukamoto et al., 2000). Intramuscular injection (i.m.) Recombinant vector construction Marek's disease and Fowlpox viruses expressing the vvIBDV host-protective antigen VP2 (rMDV, rFPV) (Tsukamoto et al., 2000). Chickens vaccinated with the rFPV or rMDV alone, or vaccinated simultaneously with both at their hatch (rMDV-rFPV(1d)) (Tsukamoto et al., 2000). VO_0003057 Most chickens were protected against developing clinical signs and mortality; however, only zero to 14% of the chickens were protected against gross lesions (Tsukamoto et al., 2000). rMDV-IBDV-VP2 VO_0004749 Recombinant vector vaccine Research Intramuscular injection (i.m.) Marek's disease and Fowlpox viruses expressing the vvIBDV host-protective antigen VP2 (rMDV, rFPV) (Tsukamoto et al., 2000). Intramuscular injection (i.m.) Recombinant vector construction IBDV host-protective antigen VP2 was expressed in a recombinant vaccine vector (Tsukamoto et al., 2000). Chickens vaccinated with the rFPV or rMDV alone, or vaccinated simultaneously with both at their hatch (rMDV-rFPV(1d)) (Tsukamoto et al., 2000). VO_0003057 Most chickens were protected against developing clinical signs and mortality; however, only zero to 14% of the chickens were protected against gross lesions (Tsukamoto et al., 2000). VP2 Infectious bursal disease virus strain GX 32482035 CDD:280020 10995 ? VP2 4.01 14476.16 208 type: vvIBDV >AAP84370.1 VP2, partial [Infectious bursal disease virus] YTITAADDYQFSSQYQAGGVTITLFSANIDAITSLSIGGELVFQTSVQGLILGATIYLIGFDGTAVITRA VAADNGLTAGTDNLMPFNIVIPTSEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAVTIHGGNYPGA LRPVT Protective antigen VP2-VP4-VP3 Infectious bursal disease virus strain 3529/92 serotype 1 452029936 CDD:280020 CDD:280022 CDD:280021 10995 ? polyprotein 5.6 102895.25 1086 subtype: vvIBDV >AGF91988.1 polyprotein [Infectious bursal disease virus] MTNLQDQTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGA HYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVS YNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITA ADDYQFSSQYQAGGVTITLFSANIDAITSLSIGGELVFQTSVQGLILGATIYLIGFDGTAVITRAVAADN GLTAGTDNLMPFNIVIPTSEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVT LVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYT DFREYFMEVADLNSPLKIAGAFGFKDIIRALRRIAVPVVSTLFPPAAPLAHAIGEGVDYLLGDEAQAASG TARAASGKARAASGRIRQLTLAADKGYEVVANLFQVPQNPVVDGILASPGILRGAHNLDCVLREGATLFP VVITTVEDAMTPKALNSKMFAVIEGVREDLQPPSQRGSFIRTLSGHRVYGYAPDGVLPLETGRDYTVVPI DDVWDDSIMLSNDPIPPIVGNSGNLAIAYMDVFRPKVPIHVAMTGALNAYGEIENVSFRSTKLATAHRLG LKLAGPGAFDVNTGSNWATFIKRFPHNPRDWDRLPYLNLPYLPPNAGRQYDLAMAASEFKETPELESAVR AMEAAANVDPLFQSALSVFMWLEENGIVTDMANFALSDPNAHRMRNFLANAPQAGSKSQRAKYGTAGYGV EARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHA EKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKHRNPRRA PPKPKPKPNVPTQRPPGRLGRWIRAVSDEDLE Protective antigen Butter et al., 2013 journal Butter C, Staines K, van Hateren A, Davison TF, Kaufman J 2013 65 8 609-618 Immunogenetics Gao et al., 2013 journal Gao H, Li K, Gao L, Qi X, Gao Y, Qin L, Wang Y, Wang X 2013 164 1-2 9-17 Veterinary microbiology Ge et al., 2015 journal Ge J, An Q, Song S, Gao D, Ping W 2015 10 7 e0132993 PloS one Heine and Boyle, 1993 journal Heine HG, Boyle DB 1993 131 3-4 277-292 Archives of virology Kumar et al., 2009 journal Kumar S, Ahi YS, Salunkhe SS, Koul M, Tiwari AK, Gupta PK, Rai A 2009 27 6 864-869 Vaccine Li et al., 2013 journal Li K, Gao H, Gao L, Qi X, Gao Y, Qin L, Wang Y, Wang X 2013 31 14 1799-1805 Vaccine Tsukamoto et al., 2000 journal Tsukamoto K, Sato T, Saito S, Tanimura N, Hamazaki N, Mase M, Yamaguchi S 2000 269 2 257-267 Virology Wiki: Infectious Bursal Disease website http://en.wikipedia.org/wiki/Infectious_bursal_disease Zhang et al., 2014 journal Zhang J, Chen XW, Tong TZ, Ye Y, Liao M, Fan HY 2014 32 6 664-670 Vaccine