Infectious Bronchitis Virus (IBV) 11120 Infectious bronchitis virus initially infects and replicates in the upper-respiratory tract causing the loss of protective cells lining the sinuses and trachea. After a brief viremia, the virus can be detected in the kidneys, reproductive tract, and cecal tonsils. Some strains of IBV, which are referred to as nephropathogenic are known to cause lesions in the kidney. Renal damage associated with different IB strains is an increasingly important feature of IB infections, especially in broiler chickens (Infectious-bronchitis.net). Infectious Bronchitis It is generally accepted that chickens are the most important natural hosts of IBV; all ages of chickens can be infected. IBV, or closely related coronaviruses have also been isolated from other species such as turkeys, pheasants, quail and partridges (Infectious-bronchitis.net). Avian infectious bronchitis virus (IBV) is a coronavirus which infects poultry, causing the associated disease, infectious bronchitis (IB) (Wiki: Infectious Bronchitis Virus). Infectious bronchitis is an acute, rapidly spreading, viral disease of chickens characterized by respiratory signs, decreased egg production, and poor egg quality. Some strains of the causative virus, infectious bronchitis virus (IBV), are nephropathogenic. The latter strains produce interstitial nephritis resulting in significant mortality. Infectious bronchitis is of major economic importance to commercial chicken producers worldwide. IBV is shed by infected chickens in respiratory discharges and feces. The highly contagious virus is spread by airborne droplets, ingestion of contaminated feed and water, and contaminated equipment and clothng of caretakers. Naturally infected chickens and those vaccinated with live IBV may intermittently shed virus for many weeks or even months. Virus infection in layers and breeders occurs cyclically as immunity declines or on exposure to different serotypes. (Merck Vet Manual: Infectious Bronchitis). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 Ac-CMV-S1 (infectious bronchitis virus) VO_0004753 Recombinant vector vaccine Research Intramuscular injection (i.m.) BV-Dual-S1 expresses the S1 glycoprotein of IBV-M41 on the baculovirus envelope, and is capable of expressing it in mammalian cells (Zhang et al., 2014). Intramuscular injection (i.m.) Recombinant vector construction The BacMam virus Ac-CMV-S1, which expressed the S1 glycoprotein of IBV-M41 (Zhang et al., 2014). The chickens were immunized with BV-Dual-S1 or an inactivated vaccine (Zhang et al., 2014). VO_0003057 A significant difference was not observed for protection rates between chickens immunized with BV-Dual-S1 (83%) or inactivated vaccine (89%) following challenge with virulent IBV-M41. Our findings show that the protective efficacy of BV-Dual-S1 could be significantly enhanced by baculovirus display technology (Zhang et al., 2014). The immunized chickens were challenged with a virulent IBV-M41 (Zhang et al., 2014). Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.11) Wyeth, Intervet Inc. VO_0001610 Live vaccine Licensed USA Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.1M) Wyeth VO_0001611 Live vaccine Licensed USA Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.20) Lohmann Animal Health International, Merial, Inc. VO_0001612 Live vaccine Licensed USA Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.21) Intervet Inc., Merial, Inc. VO_0001613 Live vaccine Licensed USA Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.22) Intervet Inc. VO_0001614 Live vaccine Licensed USA Bronchitis Conn Type, Live Virus Vaccine (USDA: 1231.15) Intervet Inc., Lohmann Animal Health International, Merial, Inc. VO_0001615 Live vaccine Licensed USA Bronchitis Delaware Type, Modified Live Virus Vaccine (USDA: 1231.1D) Intervet Inc. VO_0001616 Live, attenuated vaccine Licensed USA Bronchitis Georgia Type, Live Virus Vaccine (USDA: 1231.1J) Wyeth, Intervet Inc. VO_0001617 Live vaccine Licensed USA Bronchitis Georgia Type, Live Virus Vaccine (USDA: 1231.1L) Intervet Inc. VO_0001618 Live vaccine Licensed USA Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1235.15) Lohmann Animal Health International VO_0001619 Inactivated or "killed" vaccine Licensed USA Bronchitis Mass & Ark Types, Live Virus Vaccine (USDA: 1231.13) Wyeth, Intervet Inc. VO_0001620 Live vaccine Licensed USA Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA: 1231.14) Wyeth, Merial, Inc. VO_0001621 Live vaccine Licensed USA Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA: 1231.1G) Intervet Inc. VO_0001622 Live vaccine Licensed USA Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA:1231.1N) Intervet Inc. VO_0001623 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.12) Intervet Inc., Lohmann Animal Health International VO_0001624 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.18) Intervet Inc., Lohmann Animal Health International VO_0001625 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.1A) Intervet Inc. VO_0001626 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.1F) Intervet Inc. VO_0001627 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1232.10) Merial, Inc. VO_0001628 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1232.15) Merial, Inc. VO_0001629 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1233.10) Merial, Inc. VO_0001630 Live vaccine Licensed USA Bronchitis Mass Type, Live Virus Vaccine (USDA: 1235.10) Intervet Inc., Lohmann Animal Health International, Biomune Company VO_0001631 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.4M) Merial, Inc. VO_0002069 Live vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.67) Merial, Inc. VO_0002070 Live vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.40) Wyeth VO_0002071 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.43) Lohmann Animal Health International VO_0002072 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.62) Biomune Company VO_0002074 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12D5.45) Lohmann Animal Health International, Merial, Inc. VO_0002060 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12J5.61) Intervet Inc., Biomune Company VO_0002073 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00) Lohmann Animal Health International, Biomune Company VO_0002075 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01) Intervet Inc., Lohmann Animal Health International, Biomune Company VO_0002076 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40) Wyeth VO_0002078 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11) Intervet Inc. VO_0002077 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43) Lohmann Animal Health International VO_0002081 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50) Biomune Company VO_0002082 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90) Wyeth, Lohmann Animal Health International VO_0002083 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91) Wyeth, Lohmann Animal Health International VO_0002084 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41) Lohmann Animal Health International, Merial, Inc. VO_0002079 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42) Lohmann Animal Health International VO_0002080 Inactivated or "killed" vaccine Licensed USA Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0) Biomune Company VO_0002085 Inactivated or "killed" vaccine Licensed USA IBV DNA vaccine pVAX-S1 with GM-CSF adjuvant VO_0004582 DNA vaccine Research pVAX1 [Ref2716:Tan et al., 2009] Intramuscular injection (i.m.) GM-CSF (Tan et al., 2009) Intramuscular injection (i.m.) DNA vaccine construction Vaccination with pVAX-S1 plus pVAX-chGM-CSF induced a level of anti-IBV antibodies that was significantly higher than in animals receiving pVAX-S1 alone (P < 0.05) beginning on the seventh day after booster vaccination (Tan et al., 2009). VO_0003057 PBS and pVAX1 immunized groups had 0% protection efficacy. The protection efficacy in the group vaccinated with the pVAX-S1 plus pVAX- chGM-CSF was 86.7%, whereas for the group vaccinated with pVAX-S1 alone, it was 73.3%. These results suggest that chGM-CSF, used as a molecular adjuvant, can improve the protection efficacy of an IBV S1 protein DNA vaccine (Tan et al., 2009). IBV DNA vaccine pVAX1-16S1/M/N VO_0004535 DNA vaccine Research pVAX1 prime, inactivated IBV vaccine boost [Ref2653:Yan et al., 2013] Intramuscular injection (i.m.) Intramuscular injection (i.m.) S1, N, and M proteins of the virulent IBVSX16 strain (Yan et al., 2013) DNA vaccine construction DNA vaccine construction DNA vaccine construction Antibody titers of the chickens immunized with pVAX1-16S1/M/N were much higher than those of the monovalent groups (p < 0.01) (Yan et al., 2013). Chickens were immunized with the multivalent DNA vaccine twice and then boosted with an inactivated vaccine once (Yan et al., 2013). A protective rate up to 90% was observed in the pVAX1-16S1/M/N group (Yan et al., 2013). IBV DNA vaccine pVAX1-N VO_0004581 DNA vaccine Research pVAX1 prime, inactivated IBV vaccine boost [Ref2715:Guo et al., 2010] Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction VO_0003057 Priming with a DNA vaccine encoding nucleocapsid protein (pVAX1-N) and boosting with the inactivated IBV vaccine provided up to 86.7% rate of immune protection, compared to the lack of protection seen in the PBS-immunized group, where the death rate was 66.7% (Guo et al., 2010). IBV Vaccine SZ200 Live, attenuated vaccine Research intranasal immunization Live attenuated SZ200 vaccine protects chickens against IBV challenge. (Zhao et al., 2019) The GI-19 genotype vaccine strain, SZ200, was attenuated in our laboratory with 200 serial passages in SPF embryonated chicken eggs via the allantoic sac route. (Zhao et al., 2019) intranasal immunization GI-19 genotype vaccine strain SZ (Zhao et al., 2019) c. The unvaccinated challenged group C showed a maximum average ciliostasis score of 4, whereas the average ciliostasis score in the SZ200-vaccinated group was <2. The difference in ciliostasis was extremely significant between the SZ200-vaccinated group and the unvaccinated group (p < 0.01). Significant reductions in the postchallenge viral load in the tissues of the SZ 200-vaccinated groups were detected at 3, 5, and 7 dpc compared with those in the unvaccinated group (p < 0.05). (Zhao et al., 2019) Seventy-five 14-day-old SPF chickens were divided into six groups of 15 or 10 birds. Groups A (15 birds) and B (10 birds) were used as the negative controls. Groups C (15 birds) and D (10 birds) were vaccinated intranasally with 103.5 EID50 SZ200. Groups E (15 birds) and F (10 birds) were left unvaccinated. (Zhao et al., 2019) Compared with the unvaccinated challenged group (60% morbidity, 10% mortality), the SZ200 vaccine reduced the morbidity and mortality of the chickens infected with LGD. (Zhao et al., 2019) In terms of the clinical manifestations, no gross lesions were observed in the SZ200-vaccinated group. (Zhao et al., 2019) All groups were challenged intranasally with LGD at a dose of 10^6.0 EID50/bird at 14 days postvaccination. (Zhao et al., 2019) Infectious Bronchitis Virus DNA Vaccine encoding S1, N, and M VO_0004584 DNA vaccine Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction DNA vaccine construction DNA vaccine construction Anti-IBV antibody levels were detected in chickens immunized with either pVAX1-S1, pVAX1-M, pVAX1-N or the three constructs in combination. In fact, a higher antibody titer level was observed in chickens immunized with the three expression constructs in combination compared with the individual constructs, suggesting a greater potency for inducing antibody response (Yang et al., 2009). The seven day old SPF chickens were randomly divided into six groups with 20 chickens per group. Groups 1–3 received 100 micro-g of pVAX1-S1, PVAX1-M, or pVAX1-N, respectively; Group 4 received 100 micro-g combined DNA vaccine containing 33 micro-g of each of the three antigen plasmids; Groups 5–6 received 100 micro-g empty pVAX1 and 0.5 ml PBS. All the chickens were immunized intramuscularly with the vaccines at seven days of age (Yang et al., 2009). VO_0003057 Immunization with the multivalent DNA vaccine provided up to 85% immune protection in the vaccinated chickens (Yang et al., 2009). All chickens were challenged with 100EID50 of the IBV SAIBk strain in 0.1 ml by a nasal-ocular route at 21 days after the boost immunization (Yang et al., 2009). Newcastle Disease-Bronchitis Mass & Ark Types, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D7.10) Lohmann Animal Health International VO_0002282 Inactivated or "killed" vaccine Licensed USA Newcastle Disease-Bronchitis Mass & Ark Types, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D7.11) Lohmann Animal Health International VO_0002283 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1761.13) Merial, Inc. VO_0002150 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1761.1A) Intervet Inc. VO_0002156 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1762.13) Merial, Inc. VO_0002158 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 1791.1X) Intervet Inc. VO_0002176 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A1.1M) Wyeth, Merial, Inc. VO_0002177 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A1.1N) Intervet Inc. VO_0002178 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A2.1M) Merial, Inc. VO_0002179 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.14) Wyeth, Intervet Inc., Merial, Inc. VO_0002151 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.15) Merial, Inc. VO_0002152 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.17) Lohmann Animal Health International VO_0002153 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1762.1H) Merial, Inc. VO_0002159 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1791.14) Intervet Inc. VO_0002173 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1791.15) Intervet Inc. VO_0002174 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.11) Wyeth, Merial, Inc. VO_0002148 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.12) Intervet Inc., Lohmann Animal Health International, Merial, Inc. VO_0002149 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.18) Wyeth, Intervet Inc. VO_0002154 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.19) Intervet Inc. VO_0002155 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1762.11) Merial, Inc. VO_0002157 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1791.19) Intervet Inc. VO_0002175 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1791.1X) Intervet Inc. VO_0002176 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, C2 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1XC1.10) Intervet Inc. VO_0002204 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, C2 Strain, Mass Type, Live Virus Vaccine (USDA: 1XB1.10) Intervet Inc. VO_0002203 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types Vaccine (USDA: 17B1.17) Intervet Inc. VO_0002180 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1771.14) Intervet Inc., Merial, Inc. VO_0002162 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1771.17) Merial, Inc. VO_0002163 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.11) Wyeth, Lohmann Animal Health International, Merial, Inc. VO_0002160 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.12) Wyeth, Merial, Inc. VO_0002161 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.18) Intervet Inc., Lohmann Animal Health International VO_0002164 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.19) Intervet Inc. VO_0002165 Live vaccine Licensed USA Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.1A) Intervet Inc. VO_0002166 Live vaccine Licensed USA Newcastle-Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1785.10) Lohmann Animal Health International VO_0002170 Licensed USA Newcastle-Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1785.12) Merial, Inc. VO_0002172 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1775.10) Wyeth, Biomune Company VO_0002167 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1775.11) Intervet Inc. VO_0002168 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1776.10) Wyeth VO_0002169 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1785.11) Lohmann Animal Health International VO_0002171 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B5.10) Lohmann Animal Health International VO_0002275 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B6.10) Wyeth, Intervet Inc. VO_0002276 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D6.10) Wyeth, Intervet Inc., Biomune Company VO_0002281 Inactivated or "killed" vaccine Licensed USA Newcastle-Bronchitis VG/GA Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 17V1.10) Merial, Inc. VO_0002185 Live vaccine Licensed USA Newcastle-Bronchitis VG/GA Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 17V1.11) Merial, Inc. VO_0002186 Live vaccine Licensed USA M membrane protein Infectious bronchitis virus 1489743 9626542 IBVgp4 M22014 NP_040835 11120 24504 25181 + membrane protein 8.3 23788.52 225 ORF for gene 4 >NC_001451.1:24504-25181 Avian infectious bronchitis virus, complete genome GATGCCCAACGAGACAAATTGTACTCTTGACTTTGAACAGTCAGTTCAGCTTTTTAAAGAGTATAATTTA TTTATAACTGCATTCTTGTTGTTCTTAACCATAATACTTCAGTATGGCTATGCAACAAGAAGTAAGGTTA TTTATACACTGAAAATGATAGTGTTATGGTGCTTTTGGCCCCTTAACATTGCAGTAGGTGTAATTTCATG TACATACCCACCAAACACAGGAGGTCTTGTCGCAGCGATAATACTTACAGTGTTTGCGTGTCTGTCTTTT GTAGGTTATTGGATCCAGAGTATTAGACTCTTTAAGCGGTGTAGGTCATGGTGGTCATTTAATCCAGAAT CTAATGCCGTAGGTTCAATACTCCTAACTAATGGTCAACAATGTAATTTTGCTATAGAGAGTGTGCCAAT GGTGCTTTCTCCAATTATAAAGAATGGTGTTCTTTATTGTGAGGGTCAGTGGCTTGCTAAGTGTGAACCA GACCACTTGCCTAAAGATATATTTGTTTGTACACCGGATAGACGTAATATCTACCGTATGGTGCAGAAAT ATACTGGTGACCAAAGCGGAAATAAGAAAAGGTTTGCTACGTTTGTCTATGCAAAGCAGTCAGTAGATAC TGGCGAGCTAGAAAGTGTAGCAACAGGAGGAAGTAGTCTTTACACATA >NP_040835.1 membrane protein [Infectious bronchitis virus] MPNETNCTLDFEQSVQLFKEYNLFITAFLLFLTIILQYGYATRSKVIYTLKMIVLWCFWPLNIAVGVISC TYPPNTGGLVAAIILTVFACLSFVGYWIQSIRLFKRCRSWWSFNPESNAVGSILLTNGQQCNFAIESVPM VLSPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNIYRMVQKYTGDQSGNKKRFATFVYAKQSVDT GELESVATGGSSLYT Protective antigen N protein Infectious bronchitis virus strain M41 serotype Massachussets 157058858 CDD:279305 11120 ? nucleocapsid protein 10.29 43358 479 Coronavirus nucleocapsid protein; pfam00937 >ABV03163.1 nucleocapsid protein [Infectious bronchitis virus] MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNVSWFQAIKAKKLNSPPPKFEGSGVPDNENLKPSQQHGY WRRQARFKPGKGGRKPVPDAWYFYYTGTGPAANLNWGDSQDGIVWVAGKGADTKFRSNQGTRDSDKFDQY PLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSREVSRGRRSGSEDDLIARAARIIQDQQKK GSRITKAKADEMAHRRYCKRTIPPNYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHA CLFGSRVTPRLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPTDDEPRPKSRSSSKPATRG NSPAPRQQRPKKEKKPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL Protective antigen S1 Infectious bronchitis virus 55501832 CDD:279880 11120 ? S1 7.94 57519.94 621 Coronavirus S1 glycoprotein; pfam01600 >AAV52771.1 S1, partial [Infectious bronchitis virus] MLVKSLFIVTLLFALCSANLYDNGNYVYYYQSAFRPSGGWHLHGGAYAVVNVSQETSNAGSSSQCITGAI HWSKNFSASSVAMTAPSNGMEWSSSQFCTAHCNFSNIVVFVTHCFKSGAGFCPLTGLIPKGYIRIAAMKQ GGNGPSDLFYNLTVPVTKYPKFRSLQCVNNQTSVYLNGDLVFTSNETEDVSGSGVYFKAGGPITYKVMRE VKALAYFVNGTAHDVILCDDTPRGLLACQYNTGNFSDGFYPFTNSSLVKEKFIVYRENSVNTTLVLHNFT FYNETAAQPNSGGVNSIQTYQTQTAQSGYYNFNFSFLSGFVYKEFNFMYGSYHPKCNFRPENINNGLWFN SLSVSLAYGPLQGGCKQSVFHGRATCCYAYSYLGPRLCKGVYSGELTQQFECGLLVYITKSDGSRIQTAT EPPVITQHNYNNITLNKCVEYNIYGRFGQGFITNVTDSAASYNYLSDGGLATLDTSGAIDIFVVQGEYGL NYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQAIENQFYIKLTNGSRRSRRSVNENVTNCPYVSY Protective antigen Guo et al., 2010 journal Guo Z, Wang H, Yang T, Wang X, Lu D, Li Y, Zhang Y 2010 167 1 84-89 Journal of virological methods Infectious-bronchitis.net website http://www.infectious-bronchitis.com Leyson et al., 2016 journal Leyson C, França M, Jackwood M, Jordan B 2016 498 218-225 Virology Merck Vet Manual: Infectious Bronchitis website http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/206500.htm Tan et al., 2009 journal Tan B, Wang H, Shang L, Yang T 2009 154 7 1117-1124 Archives of virology Wiki: Infectious Bronchitis Virus website http://en.wikipedia.org/wiki/Avian_infectious_bronchitis_virus Yan et al., 2013 journal Yan F, Zhao Y, Hu Y, Qiu J, Lei W, Ji W, Li X, Wu Q, Shi X, Li Z 2013 14 1 53-60 Journal of veterinary science Yang et al., 2009 journal Yang T, Wang HN, Wang X, Tang JN, Gao R, Li J, Guo ZC, Li YL 2009 71 12 1585-1590 The Journal of veterinary medical science / the Japanese Society of Veterinary Science Zhang et al., 2014 journal Zhang J, Chen XW, Tong TZ, Ye Y, Liao M, Fan HY 2014 32 6 664-670 Vaccine Zhang et al., 2014 journal Zhang J, Chen XW, Tong TZ, Ye Y, Liao M, Fan HY 2014 32 6 664-670 Vaccine