Borrelia burgdorferi 139 B. burgdorferi is deposited in skin lesions left by Ixodes ticks, and can then invade the bloodstream leading to dissemination throughout the body and cause problems in joints and nervous tissues (Salyers and Whitt., 2002). Lyme Disease In most people B. burgdorferi is cleared from the bloodstream via antibodies and phagocytic cells (Salyers and Whitt., 2002). White footed mouse are the reservoir of B. burgdorferi. The bacteria are carried by ticks which vector the bacteria to other hosts such as humans, as well as small mammals such as voles and shrews. Animal models include rabbits, mice and dogs (Salyers and Whitt., 2002). Borrelia burgdorferi is a species of Gram negative bacteria of the spirochete class of the genus Borrelia. B. burgdorferi is predominant in North America, but also exists in Europe, and is the agent of Lyme disease. It is a zoonotic, vector-borne disease transmitted by ticks and is named after the researcher Willy Burgdorfer who first isolated the bacterium in 1982. B. burgdorferi is one of the few pathogenic bacteria that can survive without iron, having replaced all of its iron-sulfur cluster enzymes with enzymes that use manganese, thus avoiding the problem many pathogenic bacteria face in acquiring iron (Wiki: B. burgdorferi). Baboon Papio cynocephalus 9556 Bank vole Clethrionomys glareolus 447135 Bear Ursus americanus 9643 Birds Passeroidea 175121 Brown Trout Salmo trutta 8032 Buffalo Bison bison 9901 Carnivores Vulpes 9625 Cat Felis catus 9685 Catfishes Siluriformes 7995 Cattle Bos taurus 9913 Chicken Gallus gallus 9031 Chimpanzee Pan troglodytes 9598 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer Cervus elaphus 9860 Deer mouse Peromyscus maniculatus 10042 Dog Canis familiaris 9615 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Fish Hyperotreti 117565 Gerbil Gerbillina 10045 Goat Capra hircus 9925 Gray wolf Canis lupus 9612 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Macaque Macaca fascicularis 9541 Mongolian Gerbil Meriones unguiculatus 10047 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 None None Parrot Psittacidae 9224 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rainbow trout Oncorhynchus mykiss 8022 Rat Rattus 10114 Raven Corvus corax 56781 sei whale Balaenoptera borealis 9768 Sheep Ovis aries 9940 Squirrel Spermophilus richardsonii 37591 Tree shrew Tupaiidae 9393 Trouts, salmons & chars Salmoninae 504568 Turkey Meleagris gallopavo 9103 Vole Microtus ochrogaster 79684 Water buffalo Bubalus bubalis 391902 B. burgdorferi DbpA and OspA Protein Vaccine VO_0004188 Subunit vaccine Research Intraperitoneal injection (i.p.) Freund's adjuvant Intraperitoneal injection (i.p.) DbpAN40-OspAN40 Recombinant protein preparation Recombinant protein preparation C3H/HeJ Mice were immunized by intraperitoneal injection of 10 μg of DbpAN40, 10 μg of OspAN40, 5 μg of DbpAN40 plus 5 μg of OspAN40, or 2.5 μg of E. coli protein extract with complete Freund's adjuvant and then, 4 weeks later, were given a second immunization of protein in incomplete Freund's adjuvant (Hanson et al., 2000). All mice immunized with the combined DbpAN40-OspAN40 vaccine (5 μg of each antigen) were protected against even the highest challenge dose of 10^6 spirochetes (Hanson et al., 2000). At week 6, five of the mice in each immunization group were challenged by subcutaneous injection, into the dorsolateral thorax, of cloned B. burgdorferi N40 (Hanson et al., 2000). B. burgdorferi DbpA Protein Vaccine VO_0004027 Subunit vaccine Research Intraperitoneal injection (i.p.) Freund's adjuvant Intraperitoneal injection (i.p.) The recombinant fusion lipoprotein pp2:DbpAN40(His)6 (DbpAN40) (Hanson et al., 2000). Recombinant protein preparation C3H/HeJ Mice were immunized by intraperitoneal injection of 10 μg of DbpAN40, 10 μg of OspAN40, 5 μg of DbpAN40 plus 5 μg of OspAN40, or 2.5 μg of E. coli protein extract with complete Freund's adjuvant and then, 4 weeks later, were given a second immunization of protein in incomplete Freund's adjuvant (Hanson et al., 2000). Mice immunized with recombinant DbpA protein are protected against challenge with Borrelia burgdorferi. Nearly all mice immunized with 10 μg of DbpAN40 were protected from challenge with 10^3 or 10^4 spirochetes (Hanson et al., 2000). At week 6, five of the mice in each immunization group were challenged by subcutaneous injection, into the dorsolateral thorax, of cloned B. burgdorferi N40 (Hanson et al., 2000). B. burgdorferi DNA vaccine encoding strain B31 OspA VO_0004513 DNA vaccine Research VR2210 [Ref2523:Luke et al., 1997] Intramuscular injection (i.m.) Intramuscular injection (i.m.) DNA vaccine construction Sera from mice immunized with the ospA-bearing plasmid DNA had high levels of antibody that recognized both native and rOspA lipoprotein (Luke et al., 1997). Female C3H/HeN mice (6-10 weeks old) were injected with plasmid diluted in sterile 0.9% saline. Each mouse received intramuscular injections into left and right rectus femoris muscles with 50 J-lg of plasmid in 50 J-lL of saline. For immunization with protein, mice were injected in the back with purified B31 rOspA lipoprotein (Luke et al., 1997). VO_0000286 Immunization with VR2210 protected 100% of mice against infection with Sh-2-82 or N40, 2 infectious strains of B. burgdorferi (Luke et al., 1997). Mice were challenged intradermally by injecting 100 x ID50 of the infectious isolate at the base of the tail (Luke et al., 1997). B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato VO_0004413 DNA vaccine Research pCMV-TPA/ZS7 [Ref2524:Scheiblhofer et al., 2003] Intradermal injection (i.d.) Intradermal injection (i.d.) DNA vaccine construction Both i.d. injection and gene-gun application of plasmid DNA encoding the ospC gene induced a reliable humoral response with high antibody titers, antigen-specific cellular responses and, most importantly, provided effective protection (Scheiblhofer et al., 2003). VO_0000286 The protection rate after challenge with 10 B. burgdorferi organisms per mouse was between 80% and 100% for all groups. These results demonstrate that a DNA vaccine encoding OspC of B. burgdorferi is suitable for inducing protection against Lyme borreliosis (Scheiblhofer et al., 2003). Control groups received challenge doses B. burgdorferi strain ZS7 of 10^4, 10^3, 10^2, and 10 live spirochetes per animal (Scheiblhofer et al., 2003). B. burgdorferi OspA Protein Vaccine VO_0004028 Subunit vaccine Research Intraperitoneal injection (i.p.) Freund's adjuvant (Probert and LeFebvre, 1994). Intraperitoneal injection (i.p.) Recombinant OspA protein Recombinant protein preparation C3H/HeN Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994). Mice immunized with recombinant OspA protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994). Ten days following the final boost, mice received a subcutaneous inoculation containing 10^7 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994). B. burgdorferi OspB Protein Vaccine VO_0004029 Recombinant vector vaccine Research Intraperitoneal injection (i.p.) 200 μL of complete Freund's adjuvant Intraperitoneal injection (i.p.) Recombinant OspB protein Recombinant protein preparation C3H/HeN Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994). Mice immunized with recombinant OspB protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994). Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994). B. burgdorferi OspC Protein Vaccine VO_0004030 Subunit vaccine Research Intraperitoneal injection (i.p.) 200 μL of complete Freund's adjuvant Intraperitoneal injection (i.p.) Recombinant OspC protein Recombinant protein preparation C3H/HeN Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994). Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi (Hanson et al., 1998). Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994). Borrelia burgdorferi fla mutant vaccine VO_0002809 Live, attenuated vaccine Research Intradermal injection (i.d.) Intradermal injection (i.d.) Gene mutation This fla mutant is from Borrelia burgdorferi (Sadziene et al., 1996). A fla mutant is attenuated in SCID mice (Sadziene et al., 1996). A fla mutant induces protection in mice from challenge with wild type B. burgdorferi 28 days after inoculation (Sadziene et al., 1996). Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47A5.20) Wyeth, Boehringer Ingelheim Vetmedica, Inc. VO_0002239 Inactivated or "killed" vaccine Licensed USA Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21) Wyeth VO_0002244 Inactivated or "killed" vaccine Licensed USA Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20) Wyeth VO_0002243 Inactivated or "killed" vaccine Licensed USA Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20) Wyeth VO_0002241 Live, attenuated vaccine; Inactivated or "killed" vaccine Licensed USA Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29) Wyeth VO_0002242 Live, attenuated vaccine; Inactivated or "killed" vaccine Licensed USA Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21) Wyeth VO_0002219 Live, attenuated vaccine; Inactivated or "killed" vaccine Licensed USA licensed Lyme disease human vaccine Generic Unknown VO_0000764 Subunit vaccine Licensed A generic representation of vaccines utilized to prevent Lyme disease in humans, most notably based on subunit formulations containing recombinant outer surface protein A (OspA) from Borrelia burgdorferi. These vaccines aim to elicit protective immunity without using whole bacteria. DbpA Borrelia burgdorferi 297 VO_0012387 8319341 256041910 Bbu297_A24 U75866 YP_003110629 521009 297_lp54 13807 14370 - decorin binding protein A 9.68 19412.03 187 identified by match to protein family HMM PF02352 >NC_013128.1:13807-14370 Borrelia burgdorferi 297 plasmid 297_lp54, complete sequence ATTACGATTTAGCAGTGCTGTCTTCGGTATTTTTTTTCTTTAAGGTGTCTTGGTTTTTCTTGTGAACCCT TTGTAATTTTTCTCTCATTTTTTTTGCAATTTCAAGCACTCCTTGAGCTGTAGTTGGAGGATTCTCTTCA GCTGCCATTGAGACTGTTTTTGTCATCTCTTGTATTCCCAATTCTTGTAATGGTTTTGAGACTTCAAACA TTAAATCATACATTGCTGAGAATTCACCACTACTTCCAGTTTCTTTAAGTTTAGTAGCTTCCTCTTCTAT TGCTATTACGAATTTTTCCGCTACTGTAGTAGCTCGCACTTTTGCTTCAAGTATGAATGGATTTTCTGAT ACCCCACTACCCGTTTTTTTATCTTTAAAGGCATCAAAATTTACACCCATAGAAGCAGCCTTTTTTTTAA TTGCATCTATTTCATCTACAATGGCTTTAGCTGATGATTCTAATTTGATTTTTGTTGCTCCTGTTAGTCC ACATGATATAAGTAGGTTAACAAGTATAGTTAGTTTAAGTAAATTGTTAAAAGTTTTATTATTACATTTA ATCA >YP_003110629.1 decorin binding protein A (plasmid) [Borreliella burgdorferi 297] MIKCNNKTFNNLLKLTILVNLLISCGLTGATKIKLESSAKAIVDEIDAIKKKAASMGVNFDAFKDKKTGS GVSENPFILEAKVRATTVAEKFVIAIEEEATKLKETGSSGEFSAMYDLMFEVSKPLQELGIQEMTKTVSM AAEENPPTTAQGVLEIAKKMREKLQRVHKKNQDTLKKKNTEDSTAKS Protective antigen Mice immunized with recombinant DbpA protein are protected against challenge with Borrelia burgdorferi [Ref1495:Hanson et al., 2000]. fla Borrelia burgdorferi HB19 435009 CDD:183758 CDD:144315 CDD:144340 GOA:Q44895 HSSP:1ORY InterPro:IPR001029 InterPro:IPR001444 InterPro:IPR001492 InterPro:IPR019776 UniProtKB/TrEMBL:Q44895 139 ? flagellin 336 flagellin; Provisional >gi|435009|emb|CAA53011.1| flagellin [Borrelia burgdorferi] MIINHNTSAINASRNNGINAANLSKTQEKLSSGYRINRASDDAAGMGVSGKINAQIRGLSQASRNTSKAI NFIQTTEGNLNEVEKVLVRMKELAVQSGNGTYSDADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKS ASQNVRTAEELGMQPAKINTPASLSGSQASWTLRVHVGAPQDEAIAVNIYAANVANLFSGEGAQTAQAAP VQEGVQQEGAQQPAPATAPSQGGVNSPVNVTTTVDANTSLAKIENAIRMISDQRPNLGAFQNRLESIKDS TEYAIENLKASYAQIKDATMTDEVVAATTNSILTQSAMAMIAQANQLPQYVLSLLR Virmugen A flagella-less mutant of Borrelia burgdorferi (HB19Fla-) was attenuated in immunodeficient SCID mice. Mice were challenged 28 days later with virulent strain Sh. 2 and were protected from challenge [Ref2055:Sadziene et al., 1996]. OspA Borrelia burgdorferi B31 VO_0012384 1194357 11496927 BB_A15 AE000790 NP_045688 2HKD 224326 lp54 9456 10277 + outer surface protein A 9.36 26986.42 273 similar to SP:P14013 GB:L23137 GB:L23138 GB:L23139 GB:L23140 percent identity: 98.90; identified by sequence similarity; putative >NC_001857.2:9456-10277 Borrelia burgdorferi B31 plasmid lp54, complete sequence TATGAAAAAATATTTATTGGGAATAGGTCTAATATTAGCCTTAATAGCATGTAAGCAAAATGTTAGCAGC CTTGACGAGAAAAACAGCGTTTCAGTAGATTTGCCTGGTGAAATGAAAGTTCTTGTAAGCAAAGAAAAAA ACAAAGACGGCAAGTACGATCTAATTGCAACAGTAGACAAGCTTGAGCTTAAAGGAACTTCTGATAAAAA CAATGGATCTGGAGTACTTGAAGGCGTAAAAGCTGACAAAAGTAAAGTAAAATTAACAATTTCTGACGAT CTAGGTCAAACCACACTTGAAGTTTTCAAAGAAGATGGCAAAACACTAGTATCAAAAAAAGTAACTTCCA AAGACAAGTCATCAACAGAAGAAAAATTCAATGAAAAAGGTGAAGTATCTGAAAAAATAATAACAAGAGC AGACGGAACCAGACTTGAATACACAGGAATTAAAAGCGATGGATCTGGAAAAGCTAAAGAGGTTTTAAAA GGCTATGTTCTTGAAGGAACTCTAACTGCTGAAAAAACAACATTGGTGGTTAAAGAAGGAACTGTTACTT TAAGCAAAAATATTTCAAAATCTGGGGAAGTTTCAGTTGAACTTAATGACACTGACAGTAGTGCTGCTAC TAAAAAAACTGCAGCTTGGAATTCAGGCACTTCAACTTTAACAATTACTGTAAACAGTAAAAAAACTAAA GACCTTGTGTTTACAAAAGAAAACACAATTACAGTACAACAATACGACTCAAATGGCACCAAATTAGAGG GGTCAGCAGTTGAAATTACAAAACTTGATGAAATTAAAAACGCTTTAAAATA >NP_045688.1 outer surface protein A (plasmid) [Borreliella burgdorferi B31] MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKN NGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRA DGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAAT KKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK Protective antigen Mice immunized with recombinant OspA protein were protected from challenge with Borrelia burgdorferi [Ref1493:Probert and LeFebvre, 1994]. OspB Borrelia burgdorferi B31 VO_0012385 1194340 365823348 BB_A16 AE000790 NP_045689 224326 lp54 10287 11177 + outer surface protein B 9.6 30144.4 296 similar to GB:L23136 SP:P17739 GB:L23137 GB:L23138 GB:L23139 percent identity: 98.65; identified by sequence similarity; putative >NC_001857.2:10287-11177 Borrelia burgdorferi B31 plasmid lp54, complete sequence TATGAGATTATTAATAGGATTTGCTTTAGCGTTAGCTTTAATAGGATGTGCACAAAAAGGTGCTGAGTCA ATTGGTTCTCAAAAAGAAAATGATCTAAACCTTGAAGACTCTAGTAAAAAATCACATCAAAACGCTAAAC AAGACCTTCCTGCGGTGACAGAAGACTCAGTGTCTTTGTTTAATGGTAATAAAATTTTTGTAAGCAAAGA AAAAAATAGCTCCGGCAAATATGATTTAAGAGCAACAATTGATCAGGTTGAACTTAAAGGAACTTCCGAT AAAAACAATGGTTCTGGAACCCTTGAAGGTTCAAAGCCTGACAAGAGTAAAGTAAAATTAACAGTTTCTG CTGATTTAAACACAGTAACCTTAGAAGCATTTGATGCCAGCAACCAAAAAATTTCAAGTAAAGTTACTAA AAAACAGGGGTCAATAACAGAGGAAACTCTCAAAGCTAATAAATTAGACTCAAAGAAATTAACAAGATCA AACGGAACTACACTTGAATACTCACAAATAACAGATGCTGACAATGCTACAAAAGCAGTAGAAACTCTAA AAAATAGCATTAAGCTTGAAGGAAGTCTTGTAGGCGGAAAAACAACAGTGGAAATTAAAGAAGGTACTGT TACTCTAAAAAGAGAAATTGAAAAAGATGGAAAAGTAAAAGTCTTTTTGAATGACACTGCAGGTTCTAAC AAAAAAACAGGTAAATGGGAAGACAGTACTAGCACTTTAACAATTAGTGCTGACAGCAAAAAAACTAAAG ATTTGGTGTTCTTAACAGATGGTACAATTACAGTACAACAATACAACACAGCTGGAACCAGCCTAGAAGG ATCAGCAAGTGAAATTAAAAATCTTTCAGAGCTTAAAAACGCTTTAAAATA >NP_045689.2 outer surface protein B (plasmid) [Borreliella burgdorferi B31] MRLLIGFALALALIGCAQKGAESIGSQKENDLNLEDSSKKSHQNAKQDLPAVTEDSVSLFNGNKIFVSKE KNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLNTVTLEAFDASNQKISSKVTK KQGSITEETLKANKLDSKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVGGKTTVEIKEGTV TLKREIEKDGKVKVFLNDTAGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEG SASEIKNLSELKNALK Protective antigen Mice immunized with recombinant OspB protein were protected from challenge with Borrelia burgdorferi [Ref1493:Probert and LeFebvre, 1994]. OspC Borrelia burgdorferi B31 VO_0012386 1194415 11497024 BB_B19 AE000792 NP_047005 1GGQ 224326 cp26 16902 17534 + outer surface protein C 8.68 21347.6 210 similar to GB:AE000792 percent identity: 100.00; identified by sequence similarity; putative >NC_001903.1:16902-17534 Borrelia burgdorferi B31 plasmid cp26, complete sequence AATGAAAAAGAATACATTAAGTGCAATATTAATGACTTTATTTTTATTTATATCTTGTAATAATTCAGGG AAAGATGGGAATACATCTGCAAATTCTGCTGATGAGTCTGTTAAAGGGCCTAATCTTACAGAAATAAGTA AAAAAATTACGGATTCTAATGCGGTTTTACTTGCTGTGAAAGAGGTTGAAGCGTTGCTGTCATCTATAGA TGAAATTGCTGCTAAAGCTATTGGTAAAAAAATACACCAAAATAATGGTTTGGATACCGAAAATAATCAC AATGGATCATTGTTAGCGGGAGCTTATGCAATATCAACCCTAATAAAACAAAAATTAGATGGATTGAAAA ATGAAGGATTAAAGGAAAAAATTGATGCGGCTAAGAAATGTTCTGAAACATTTACTAATAAATTAAAAGA AAAACACACAGATCTTGGTAAAGAAGGTGTTACTGATGCTGATGCAAAAGAAGCCATTTTAAAAACAAAT GGTACTAAAACTAAAGGTGCTGAAGAACTTGGAAAATTATTTGAATCAGTAGAGGTCTTGTCAAAAGCAG CTAAAGAGATGCTTGCTAATTCAGTTAAAGAGCTTACAAGCCCTGTTGTGGCAGAAAGTCCAAAAAAACC TTA >NP_047005.1 outer surface protein C (plasmid) [Borreliella burgdorferi B31] MKKNTLSAILMTLFLFISCNNSGKDGNTSANSADESVKGPNLTEISKKITDSNAVLLAVKEVEALLSSID EIAAKAIGKKIHQNNGLDTENNHNGSLLAGAYAISTLIKQKLDGLKNEGLKEKIDAAKKCSETFTNKLKE KHTDLGKEGVTDADAKEAILKTNGTKTKGAEELGKLFESVEVLSKAAKEMLANSVKELTSPVVAESPKKP Protective antigen Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi [Ref1493:Probert and LeFebvre, 1994]. Brandt et al., 2014 journal Brandt KS, Patton TG, Allard AS, Caimano MJ, Radolf JD, Gilmore RD 2014 21 4 526-533 Clinical and vaccine immunology : CVI Bryksin et al., 2005 journal Bryksin AV, Godfrey HP, Carbonaro CA, Wormser GP, Aguero-Rosenfeld ME, Cabello FC 2005 12 8 935-940 Clinical and diagnostic laboratory immunology Floden et al., 2013 journal Floden AM, Gonzalez T, Gaultney RA, Brissette CA 2013 20 6 892-899 Clinical and vaccine immunology : CVI Hanson et al., 1998 journal Hanson MS, Cassatt DR, Guo BP, Patel NK, McCarthy MP, Dorward DW, Höök M 1998 66 5 2143-2153 Infection and immunity Hanson et al., 2000 journal Hanson MS, Patel NK, Cassatt DR, Ulbrandt ND 2000 68 11 6457-6460 Infection and immunity Labandeira-Rey et al., 2001 journal Labandeira-Rey M, Baker EA, Skare JT 2001 69 3 1409-1419 Infection and immunity Probert and LeFebvre, 1994 journal Probert WS, LeFebvre RB 1994 62 5 1920-1926 Infection and immunity Sadziene et al., 1996 journal Sadziene A, Thompson PA, Barbour AG 1996 173 5 1184-1193 The Journal of infectious diseases Salyers and Whitt., 2002 book Abigail A. Salyers, Dixie D. Whitt 2002 187-199 Bacterial Pathogenesis: A Molecular Approach ASM Press Washington D.C. USA 1-55581-171-x Ulbrandt et al., 2001 journal Ulbrandt ND, Cassatt DR, Patel NK, Roberts WC, Bachy CM, Fazenbaker CA, Hanson MS 2001 69 8 4799-4807 Infection and immunity Wiki: B. burgdorferi website http://en.wikipedia.org/wiki/Borrelia_burgdorferi