Bovine herpesvirus 1 |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- G from BRSV
(Protective antigen)
- gB
(Protective antigen)
- gIV
(Protective antigen)
- UL44
(Protective antigen)
- UL49
(Protective antigen)
- US6
(Protective antigen)
- US7
(Protective antigen)
- UL23
(Virmugen)
- US8
(Virmugen, Virmugen)
- Vaccine Information
- BHV1 gD subunit vaccine
- Bovilis IBR Marker
- Bovine herpesvirus 1 DNA vaccine AdCMVgC
- Bovine herpesvirus 1 DNA vaccine AdCMVgD
- Bovine herpesvirus 1 DNA vaccine pMASIAtgB encoding a truncated, secreted form of gB
- Bovine herpesvirus 1 DNA vaccine pRSV-gC
- Bovine herpesvirus 1 DNA vaccine pRSVgIV
- Bovine herpesvirus 1 DNA vaccine tgD-VP22
- Bovine herpesvirus 1 GPI protein vaccine
- Bovine herpesvirus 1 recombinant vector vaccine BHVl/BRSVG
- Bovine herpesvirus 1 recombinant vector vaccine rLaSota/gDF encoding gD
- Bovine herpesvirus 1 recombinant vector vaccine rLaSota/gDFL encoding gD
- Bovine herpesvirus 1 UL23 mutant vaccine
- Bovine herpesvirus 1 US8 (gE) mutant vaccine
- Bovine Rhinotracheitis Killed Virus Vaccine (USDA: 1105.20)
- Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20)
- Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21)
- Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20)
- Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.20)
- Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.21)
- Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.22)
- Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.B0)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4019.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4059.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4069.20)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.20)
- Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.00)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.20)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.21)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.24)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.31)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 4139.20)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4129.00)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4179.00)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4209.00)
- Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.00)
- Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.20)
- Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.21)
- Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.22)
- Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.23)
- Bovine Rhinotracheitis-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11B5.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.30)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.22)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.23)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.26)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine (USDA: 1175.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.27)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.28)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C7.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44D5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44F9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11A5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30)
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
10320 |
2. Disease: |
Infectious bovine rhinotracheitis |
3. Introduction |
Bovine herpesvirus 1 (BHV-1) is a virus of the family Herpesviridae that causes several diseases worldwide in cattle, including rhinotracheitis, vaginitis, balanoposthitis, abortion, conjunctivitis, and enteritis. BHV-1 is also a contributing factor in shipping fever. It is spread through sexual contact, artificial insemination, and aerosol transmission. Like other herpesviruses, BHV-1 causes a lifelong latent infection and shedding of the virus. The sciatic nerve and trigeminal nerve are the sites of latency. There is a vaccine available which reduces the severity and incidence of disease.
The respiratory disease caused by BHV-1 is commonly known as infectious bovine rhinotracheitis. Symptoms include fever, discharge from the nose, cough, difficulty breathing, and loss of appetite. Ulcers commonly occur in the mouth and nose. Mortality may reach 10%. The genital disease causes infectious pustular vulvovaginitis in cows and infectious balanoposthitis in bulls. Symptoms include fever, depressios, loss of appetite, painful urination, a swollen vulva with pustules and discharge in cows, and pain on sexual contact in bulls. In both cases lesions usually resolve within two weeks. Abortion and stillbirths can occur one to three months postinfection. BHV-1 also causes a generalized disease in newborn calves, characterized by enteritis and death (Wiki: Bovine herpesvirus 1). |
II. Vaccine Related Pathogen Genes |
1. G from BRSV |
-
Gene Name :
G from BRSV
-
Sequence Strain (Species/Organism) :
Bovine orthopneumovirus
-
NCBI Gene ID :
1489813
-
NCBI Protein GI :
9631274
-
Locus Tag :
BovRSVgp07
-
Genbank Accession :
AF092942
-
Protein Accession :
NP_048054
-
Taxonomy ID :
11246
-
Gene Starting Position :
4689
-
Gene Ending Position :
5528
-
Gene Strand (Orientation) :
+
-
Protein Name :
mRNA
-
Protein pI :
10.63
-
Protein Weight :
27981.73
-
Protein Length :
257
-
DNA Sequence : Show Sequence
>NC_001989.1:4689-5528 Bovine respiratory syncytial virus, complete genome
TGGGGCAAATACAAGTATGTCCAACCATACCCACCATCTTAAATTCAAGACATTAAAGAGGGCTTGGAAA
GCCTCAAAATACTTCATAGTAGGATTATCATGTTTATATAAGTTCAATTTAAAATCCCTTGTCCAAACGG
CTTTGACCACCTTAGCAATGATAACCTTGACATCACTCGTCATAACAGCCATTATTTACATTAGTGTGGG
AAATGCTAAAGCCAAGCCCACATCCAAACCAACCATCCAACAAACACAACAGCCCCAAAACCATACCTCA
CCATTTTTCACAGAGCACAACTACAAATCAACTCACACATCAATTCAAAGCACCACACTGTCCCAACTAC
CAAACACAGACACCACTAGAGAAACTACATACAGTCACTCAATCAACGAAACCCAAAACAGAAAAATCAA
AAGCCAATCCACTCTACCCGCCACCAGAAAACCACCAATTAACCCATCGGGAAGCAACCCCCCTGAAAAC
CACCAAGACCACAACAACTCCCAAACACTCCCCTATGTGCCTTGCAGTACATGTGAAGGTAATCTTGCTT
GTTTATCACTCTGCCAAATCGGGCCGGAGAGAGCACCAAGCAGAGCCCCTACAATCACCCTCAAAAAGAC
TCCAAAACCCAAAACCACCAAAAAGCCAACCAAGACAACAATCCACCACAGAACCAGCCCTGAAGCCAAA
CTGCAACCCAAAAACAACACGGCAGCTCCACAACAAGGCATCCTCTCTTCACCAGAACACCACACAAATC
AATCAACTACACAGATCTAACAACACACCTCCATATAATATCAATTATGTTCATATATAGTTATTTAAAA
-
Protein Sequence : Show Sequence
>NP_048054.1 G [Bovine orthopneumovirus]
MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITAIIYISVGNAKAK
PTSKPTIQQTQQPQNHTSPFFTEHNYKSTHTSIQSTTLSQLPNTDTTRETTYSHSINETQNRKIKSQSTL
PATRKPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNLACLSLCQIGPERAPSRAPTITLKKTPKPKT
TKKPTKTTIHHRTSPEAKLQPKNNTAAPQQGILSSPEHHTNQSTTQI
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Bovine herpesvirus 1 recombinant vector vaccine BHVl/BRSVG
|
2. gB |
-
Gene Name :
gB
-
Sequence Strain (Species/Organism) :
Bovine herpesvirus 1
-
NCBI Protein GI :
349734084
-
Other Database IDs :
CDD:223014
-
Taxonomy ID :
10320
-
Gene Strand (Orientation) :
?
-
Protein Name :
glycoprotein B
-
Protein pI :
6.96
-
Protein Weight :
16194.78
-
Protein Length :
216
-
Protein Note :
glycoprotein BALF4; Provisional
-
Protein Sequence : Show Sequence
>AEQ16470.1 glycoprotein B, partial [Bovine alphaherpesvirus 1]
SKAEYLRSGRKVVAFDRDDDPWEAPLKPARLSAPGVRGWHTTDDVYTALGSAGLYRTGTSVNCIVEEVEA
RSVYPYDSFALSTGDIIYMSPFYGLREGAHREHTSYSPERFQQIEGYYKRDMATGRRLKEPVSRNFLRTQ
HVTVAWDW
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Bovine herpesvirus 1 DNA vaccine pMASIAtgB encoding a truncated, secreted form of gB
|
3. gIV |
-
Gene Name :
gIV
-
Sequence Strain (Species/Organism) :
Bovine herpesvirus 1
-
NCBI Protein GI :
330746
-
Other Database IDs :
CDD:223029
-
Taxonomy ID :
10320
-
Gene Strand (Orientation) :
?
-
Protein Name :
glycoprotein gIV
-
Protein pI :
4.96
-
Protein Weight :
42868.83
-
Protein Length :
481
-
Protein Note :
envelope glycoprotein D; Provisional
-
Protein Sequence : Show Sequence
>AAA46050.1 glycoprotein gIV [Bovine alphaherpesvirus 1]
MQGPTLAVLGALLAVAVSLPTPAPRVTVYVDPPAYPMPRYNYTERWHTTGPIPSPFADGREQPVEVRYAT
SAAACDMLALIADPQVGRTLWEAVRRHARAYNATVIWYKIESGCARPLYYMEYTECEPRKHFGYCRYRTP
PFWDSFLAGFAYPTDDELGLIMAAPARLVEGQYRRALYIDGTVAYTDFMVSLPAGDCWFSKLGAARGYTF
GACFPARDYEQKKVLRLTYLTQYYPQEAHKAIVDYWFMRHGGVVPPYFEESKGYEPPPAADGGSPAPPGD
DEAREDEGETEDGAAGREGNGGPPGPEGDGESQTPEANGGAEGEPKPGPSPDADRPEGWPSLEAITHPPP
APATPAAPDAVPVSVGIGIAAAAIACVAAAAAGAYFVYTRRRGAGPLPRKPKKLPAFGNVNYSALPG
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Bovine herpesvirus 1 DNA vaccine pRSVgIV
|
4. UL23 |
-
Gene Name :
UL23
-
Sequence Strain (Species/Organism) :
Bovine herpesvirus 1
-
NCBI Gene ID :
1487380
-
NCBI Protein GI :
9629852
-
Locus Tag :
BoHV1_gp21
-
Genbank Accession :
Z78205
-
Protein Accession :
NP_045336
-
Taxonomy ID :
10320
-
Gene Starting Position :
63259
-
Gene Ending Position :
67035
-
Gene Strand (Orientation) :
+
-
Protein Name :
thymidine kinase
-
Protein pI :
6.75
-
Protein Weight :
35103.27
-
Protein Length :
359
-
Protein Note :
2.7.1.21
-
DNA Sequence : Show Sequence
>gi|9629818:63259-67035 Bovine herpesvirus 1, complete genome
CATGGCCGAGCCCGCGCGCGCTCTCCGCGTCGTGCGTATCTACCTGGACGGCGCGCACGGGCTGGGAAAG
ACAACAACGGGCCGCGCGCTCGCGGCCGCTTCCACCGCTGGGGAGGGCGTGCTCTTTTTCCCGGAGCCGA
TGGCGTACTGGCGCACGATGTTTGGTACGGACGCCTTAAGTGGGATCCTCGCGGCGTCTGCGCGATGCGC
CGCAGCCTCGCACGGGAGCGCACGCGGCGCCGGCGGGCCGGCGCACCGCGCAGACGCGGACGCGGCGGGC
CTGGTTGCGTACTACCAGGCCAGGTTCGCGGCCCCGTACTTAATTTTGCACGCGCGCGTGTCCGCGCTGC
TGGCGCCGCCTGGGCCGGCGCCGGGCGGCACTGTGACCCTCGTGTTCGACCGCCACCCCGTGGCCGCGTG
CCTCTGCTACCCCTTCGCCCGCTACTGCCTCCGCGAGATCAACGCGGAAGATCTGCTCATGCTCGCGGCC
GCCATGCCCCCGGAAGCGCCCGGGGCCAACCTCGTCGTGTGCACCCTCCCCCCGGCCGAGCAACAGCGCC
GCCTGGCGGCGCGGGCCAGGCCCGGAGACCGCGCGGACGCGGGCTTTCTGGTCGCTGTGCGCAATGCTTA
CGCGCTCCTGGTGAACACGTGCGCTTTCCTGCGCGCGGGGGGCGCATGGCGCGACGGCTGGGACGCGCTG
GAGTGGGCGGACGCAAATGCATTGGCCGCGCTCGCAGACCCCAGTTGTGATGAATGCAAAATGGCGCCGG
CGCCGGCGCTGCGCGACACCCTGTTCGCGGCGCTCAAGTGCCGCGAGCTCTACCCGGGCGGCGGGACGGG
CTTGCCCGCGGTTCACGCCTGGGCGCTGGACGCCCTGGCCGGCCGCCTCGCCGCCCTCGAGGTGTTCGTG
CTGGACGTGTCCGCGGCGCCAGACGCGTGCGCGGCCGCCGTACTGGACATGCGGCCCGCCATGCAGGCCG
CTTGCGCGGACGGGGCGGCGGGCGCGACGCTGGCGACCCTGGCGCGTCAGTTCGCGCTAGAGATGGCGGG
GGAGGCCACGGCGGGCCCTAGGGGACTATAAAGCTGCCCCTGCGCTCGCTCGCTCGCTGCATTTGCGCCC
CGATCGCCTTACGGGGACTCGGCGCTCGGCGGATCCCCTCCCGGCCCCGCCGCGAAGCGAGCCGCCAGAC
AAAAAAATGCGGCGCCCGCTCTGCGCGGCGCTATTGGCAGCGGCTGTCCTCGCGCTCGCCGCGGGCGCCC
CCGCCGCCGCCCGCGGCGGCGCGGGGGGCCGAAGCAGGGAGCACAGAGACGCCCGATACGAAATCGAAGA
GTGGGAAATGGTGGTCGGAGCCGGGCCGGCCGTGCACACGTTCACCATCCGCTGCCTCGGGCCGCGGGGC
ATTGAGCGCGTGGCCCACATTGCAAACCTCAGCCGGCTGCTGGACGGGTACATAGCGGTCCACGTTGACG
TTGCGCGCACCTCTGGCCTGCGGGACACCATGTTTTTCCTGCCGCGCGCGGCCGTCGACAACGCTTCGGC
CGCTGACATTCCGGACACCCCGGCCGTACAGTCGCACCCGGGGCTCTTCGGGGCGGCCTTTTCCTGGAGC
TACTTGCAAACGCGCCACCTCGTAGACTACGACCTGGTGCCGAGCCGCCCCCTGCAGGACTGGTACTTTT
CGCAGGCGCGCGCCGAGAGCAACGCCGCGCGCCCGCCGCCCGCCCCGCGCGTCACACCAACGCCGGCGGG
GCGGGTGGCCGCTTTTGACATCAACGACGTGCTGGCCAGCGGCCCGGAGCACTTCTTTGTGCCTGTGCGA
GCGGACCGCAAGCGGCGCGAGCGCCACGTGGCGGATTTTGCCGCGGTGTGGCCCGTGTCCTACATCCCCG
CAGGACGGGCAGTGCTAAGCTGCGAGCGAGCCGCGGCTCGGCTGGCGGTGGGGCTCGGCTTCCTGAGCGT
CTCGGTGACGTCGCGGGACCTCCTGCCTCTGGAGTTTATGGTCGCGCCCGCGGACGCCAACGTGCGCATG
ATTACCGCCTTTAACGGGGGCGGCGCTTTTCCGCCACCCGGGCCCGCGGCCGGTCCGCAGCGGCGGGCCT
ACGTAATCGGCTACGGGAACTCGCGGCTGGACAGCCATATGTATCTGACCATGCGCGAGGTGGCGTCGTA
CGCGAACGAGCCCGCTGACTTTCGCGCGCACTTGACCGCCGCGCACCGGGAGGCTTTTTTGATGCTCCGG
GAGGCGGCAGCCGCGCGCCGCGGACCGAGCGCCGGCCCCGCGCCCAACGCTGCCTACCACGCGTACCGGG
TCGCGGCGCGGCTGGGACTCGCGCTCTCCGCGCTCACCGAGGGGGCGCTCGCGGACGGCTACGTGCTCGC
GGAGGAGCTAGTCGACCTTGACTACCACCTCAAGCTGCTGTCGCGCGTGCTGCTCGGCGCAGGGCTTGGC
TGCGCCGCCAACGGCCGCGTGCGCGCCCGCACCATCGCGCAGCTGGCCGTGCCCCGCGAGCTACGCCCGG
ACGCGTTCATCCCAGAGCCCGCCGGGGCGGCGCTCGAGAGCGTGGTGGCCCGCGGGCGCAAGCTGCGCGC
CGTGTACGCTTTTTCGGGTCCGGACGCTCCGCTAGCTGCGCGGCTGCTGGCCCACGGCGTGGTGTCGGAC
CTCTACGACGCCTTCCTGCGCGGCGAGCTGACGTGGGGGCCGCCCATGCGCCACGCGCTTTTTTTCGCCG
TCGCGGCGTCGGCGTTCCCCGCGGACGCCCAGGCGCTGGAGCTCGCGCGGGACGTGACGCGCAAGTGCAC
GGCTATGTGCACCGCCGGGCACGCCACGGCGGCCGCGCTGGACCTGGAGGAGGTATACGCGCACGTCGGC
GGCGGCGCCGGGGGCGACGCGGGCTTTGAGCTGCTGGATGCCTTCTCGCCGTGCATGGCCTCTTTCCGCC
TGGACTTGCTCGAGGAGGCGCACGTGCTGGACGTGCTCTCGGCCGTGCCCGCGCGGGCCGCGCTGGACGC
CTGGCTGGAGGCGCAGCCCGCGGCCGCCGCGCCGAACCTCAGCGCGGCGGCGCTCGGCATGCTGGGCCGG
GGAGGCCTCTTCGGCCCGGCGCACGCCGCCGCGCTCGCGCCCGAGCTCTTCGCGGCGCCCTGCGGCGGGT
GGGGCGCGGGCGCCGCCGTGGCGATCGTCCCCGTGGCGCCGAACGCTAGCTATGTCATCACGCGCGCACA
TCCGCGGCGCGGGCTGACGTACACCCTCCAGGGAATTGACGTCGCTAACCCCCTGCTGGTGACTTTTGTG
CGCGGCACGTCGTGCGTGTCGGCCAGCGGCGCGGTGGAGGCGCGCCGCCTTGCGGTCCCCGGCCCGCTGG
ACGCGTGCGCCTACTGCGGCAGCGTGTTCGTGCGATACTTGCCCTCGGGCGCGGTTATGGACATCGTGCT
CATTGCGGACAAGCGCACCGAGGTTGAGTTCTCGCGCGGCGCCAACTCTAGCATGCCCGTCTTCAACCCT
CGCCTCCACAGCGGGCGCTCCCGCGCCATGCTGCTGTTCCCCAACGGGACGGTCGTAAGCGTCCTGGCCT
TCGCCGGGCACGAAGCGCCGACGTTTTCGCCGGCGTACGTCTGGGCGTCGGTAGGCGGGGCGCTGGTCGC
GGGTACCACGATATACGCCATCGCGAAGATGCTGTGCAGCTCGGTCCCGCTCGCGCGCGGGTACTCGTCG
GTCCCGGTGTTTTAGCGCGCGCGTTGCCCTCCCCCCCTTCCCCCTTTTCACGTCTCCCCGCCAATAA
-
Protein Sequence : Show Sequence
>gi|9629852|ref|NP_045336.1| thymidine kinase [Bovine herpesvirus 1]
MAEPARALRVVRIYLDGAHGLGKTTTGRALAAASTAGEGVLFFPEPMAYWRTMFGTDALSGILAASARCA
AASHGSARGAGGPAHRADADAAGLVAYYQARFAAPYLILHARVSALLAPPGPAPGGTVTLVFDRHPVAAC
LCYPFARYCLREINAEDLLMLAAAMPPEAPGANLVVCTLPPAEQQRRLAARARPGDRADAGFLVAVRNAY
ALLVNTCAFLRAGGAWRDGWDALEWADANALAALADPSCDECKMAPAPALRDTLFAALKCRELYPGGGTG
LPAVHAWALDALAGRLAALEVFVLDVSAAPDACAAAVLDMRPAMQAACADGAAGATLATLARQFALEMAG
EATAGPRGL
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
A thymidine kinase-deficient mutant (B8-D53) showed no detectable thymidine kinase-inducing activity and was attenuated in calves. B8-D53 also induced protection from challenge with wild type BHV-1 (Kit et al., 1985).
- Related Vaccine(s):
Bovine herpesvirus 1 UL23 mutant vaccine
|
5. UL44 |
-
Gene Name :
UL44
-
Sequence Strain (Species/Organism) :
Bovine alphaherpesvirus 1
-
VO ID :
VO_0011043
-
NCBI Gene ID :
4783424
-
NCBI Protein GI :
9629830
-
Locus Tag :
BoHV1_gp105
-
Genbank Accession :
KC756965
-
Protein Accession :
NP_045314
-
Taxonomy ID :
10320
-
Gene Starting Position :
16612
-
Gene Ending Position :
18208
-
Gene Strand (Orientation) :
-
-
Protein Name :
envelope glycoprotein C
-
Protein pI :
8.25
-
Protein Weight :
50150.91
-
Protein Length :
508
-
Protein Note :
envelope glycoprotein C; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; the nonessential glycoprotein gC interacts with cell surface proteoglycans, whereas the essential glycoprotein gD is involved in stable secondary attachment
-
DNA Sequence : Show Sequence
>NC_001847.1:16612-18208 Bovine herpesvirus 1, complete genome
GTTTATTATGAAATTGTACATGCGTGGTCTTTGGGGGGGGGCGCGGCGGCTTTGCCGTCGGGGCCCCGCG
CCTACAGGCGCGCCCGGGCCTTGCGCCGCAGGCACGAGGCCGCCACCAGCAGGAGCCCCACGGCGCCGAG
ACCGCAGGCGACGGCCACGACGCTGACGAGGACGGGGCTTCCGATTAGGCCGGGCGAGGCGTCGTACGTG
GCGGTCGCGGAGAACTCGGGCAGCGGTGCCGGGTAGCCAGTGGCGGTGCAGGTGTAGTCGACGGGCCCGT
CGGTTGTAGAAAGCAGGCGCACGCCGCGCAGGTTTACCAGCCCGGGCCGCTCGGCGCAGACGCCGGTCTG
CTCAGTGCGCGACGGGGCGATGCCGTCGCGCACCGTCCAGCGCAGGGAGACGCGCCCCTCGGGGACGCAG
CGCGCCTCGCAGACGGCCTCGCCGCCCTCGAAGTACACGCGCAGCTCGGGCGGGCGGTAAACGGCCGGCG
TGCCAGCCGCGTAAAAGCGGCGCTCCATGTTAGCGCTCTGGAACCAGGAGACGTCGCAGCGCAGGTTGGG
CGGGTGGGCGGTTGGCGTCGCGTCCTCGAGCGTAAGGACGGACGTGCGCGAAAAGAGCCCGGAGTCGTCG
ACCGTAAAGACGTCGCGCGCGTGCCGAGCCTCCACGGGGTAGCCGTTGCGGAACCAGTGCAGGCGCGTGG
AGCGCGGCGGGTAGTACTCGGCGGCGCGGCACACGGCCGCGTAGCCGGCGCCTTCTAGCGCTGGCTGGGG
TTCGACGGAAACAGCGGGCGCGCGGTGCGTCGTGACGGTCACGACCTTGCGCTGTGACTTGGTGCCCATG
TCGCGGCGCCAAGTGTACACGCCCTCGGTGGCGGCCGTCAGGGAGCGCACGGTCAGGGGCAAGTTGCGGG
GGTCGGCGGGCGAAGGGAAAATATAGTTGTCGCCCAGCTCCGCGCTACGGTACGCGATCGAGCCGTTCTG
GGCTACGAACAGCAGCACGGGCGGGGCCCGCGGAAAGGGGTTGCGCACGGCCTCGTCGTCGCCGCGCGTG
GAGCGGAACCTGCCCACGCGCTGAAACCAGAGCTCCAGGCGCGCACCGCCAGTGGCGTTGTCGGCCACGC
CGCAGTGCACGTACAGCGGCTCGGCGTACGAGGCGGCCACGGCCTCGCGCTCGCAGAGCATCCACTTGCG
CTCCTTCGGCGGGGCTTTGCTCGGCCGCGGGGGGCGAGGCCGCCCCCCGCCGCTAGGTCGCCCATCGCGG
CTCGCGTTGCCAGCGCCGCCGGGTCGCCCGTCCTCGGGCGGGGCGGGCGGCGGCGTGCTGTTGGTAACGG
GCGGGTCGTGCTCGGACACGGACGGCGGCTCCGGCGTCCCCACGGGCGTAGTAGCACCGGGCGTGCTGTC
CTCTGGCGTAGCGTCGGGGCTGTTGGGCGTGGGGGGCGTTGCGCCGGTGGTCCCAGCGGAGCTTTCCGTC
TCGGTTGGGGACGGGGAGGGCGGAGGCGAGGGCGAGGCTTCCGCCTCCTCGGCGAGCCCCCGCCGGGCAG
ACAGGAGCGCCCAGGCGAAAATAGCTGCGATCAGCCACGCTCGCCCCAGCGGGCCCA
-
Protein Sequence : Show Sequence
>NP_045314.1 envelope glycoprotein C [Bovine alphaherpesvirus 1]
MGPLGRAWLIAAIFAWALLSARRGLAEEAEASPSPPPSPSPTETESSAGTTGATPPTPNSPDATPEDSTP
GATTPVGTPEPPSVSEHDPPVTNSTPPPAPPEDGRPGGAGNASRDGRPSGGGRPRPPRPSKAPPKERKWM
LCEREAVAASYAEPLYVHCGVADNATGGARLELWFQRVGRFRSTRGDDEAVRNPFPRAPPVLLFVAQNGS
IAYRSAELGDNYIFPSPADPRNLPLTVRSLTAATEGVYTWRRDMGTKSQRKVVTVTTHRAPAVSVEPQPA
LEGAGYAAVCRAAEYYPPRSTRLHWFRNGYPVEARHARDVFTVDDSGLFSRTSVLTLEDATPTAHPPNLR
CDVSWFQSANMERRFYAAGTPAVYRPPELRVYFEGGEAVCEARCVPEGRVSLRWTVRDGIAPSRTEQTGV
CAERPGLVNLRGVRLLSTTDGPVDYTCTATGYPAPLPEFSATATYDASPGLIGSPVLVSVVAVACGLGAV
GLLLVAASCLRRKARARL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
A DNA vaccine expressing glycoprotein C (gC, UL44) of bovine herpesvirus-1 (BHV-1) was evaluated for inducing immunity in bovines. Results indicate that DNA immunization with gC could induce neutralizing antibody and lymphoproliferative responses with BHV-1 responsive memory B cells in bovines. However, the immunity developed sufficient for only partial protection against BHV-1 challenge (Gupta et al., 2001).
- Related Vaccine(s):
Bovine herpesvirus 1 DNA vaccine AdCMVgC
,
Bovine herpesvirus 1 DNA vaccine pRSV-gC
|
6. UL49 |
-
Gene Name :
UL49
-
Sequence Strain (Species/Organism) :
Bovine alphaherpesvirus 1
-
VO ID :
VO_0011040
-
NCBI Gene ID :
1487397
-
NCBI Protein GI :
9629826
-
Locus Tag :
BoHV1_gp05
-
Genbank Accession :
GU591892
-
Protein Accession :
NP_045310
-
Taxonomy ID :
10320
-
Gene Starting Position :
9383
-
Gene Ending Position :
10228
-
Gene Strand (Orientation) :
+
-
Protein Name :
tegument protein VP22
-
Protein pI :
10.07
-
Protein Weight :
25574.19
-
Protein Length :
258
-
DNA Sequence : Show Sequence
>NC_001847.1:9383-10228 Bovine herpesvirus 1, complete genome
CATGGCCCGGTTCCACAGGCCCTCCGAAGACGAGGACGATTACGAGTACAGCGACCTTTGGGTGCGAGAA
AACAGCCTCTATGACTACGAGTCCGGCTCGGATGACCACGTATACGAAGAGCTGCGCGCCGCGACGAGCG
GACCCGAGCCGAGCGGGCGGCGCGCTAGCGTCCGTGCGTGCGCCAGCGCTGCAGCCGTCCAGCCCGCCGC
CCGCGGCCGCGATCGAGCCGCAGCCGCGGGGACGACCGTAGCTGCGCCCGCCGCCGCGCCGGCCCGCCGC
TCGAGCAGCCGGGCGTCCTCGCGCCCGCCGCGAGCTGCCGCCGACCCGCCCGTCCTCCGGCCAGCCACGC
GCGGGTCCTCCGGCGGCGCCGGGGCAGTCGCCGTCGGTCCACCTCGACCTCGCGCGCCCCCCGGTGCTAA
TGCTGTTGCGTCTGGCCGGCCGCTGGCGTTCAGCGCGGCTCCGAAAACGCCCAAGGCGCCCTGGTGTGGA
CCGACGCACGCCTACAACCGAACGATCTTTTGCGAGGCCGTCGCGCTCGTGGCCGCCGAGTACGCCCGGC
AGGCGGCTGCCAGCGTCTGGGACTCGGACCCCCCAAAGAGCAACGAGCGATTGGATCGCATGTTGAAGTC
GGCGGCAATTCGCATCCTCGTGTGCGAGGGCTCCGGGCTTCTCGCCGCCGCGAACGACATCTTGGCCGCG
CGGGCCCAGCGCCCCGCCGCGCGCGGGAGCACAAGCGGCGGGGAAAGCCGCCTTCGCGGCGAGCGGGCCC
GGCCGTAGCGCGAGCGGGAGGGCTTTTTCGACGCGCGCGGCTTAAGCAGCGCGCTGCTGTGCTAGTATGA
AAATAA
-
Protein Sequence : Show Sequence
>NP_045310.1 tegument protein VP22 [Bovine alphaherpesvirus 1]
MARFHRPSEDEDDYEYSDLWVRENSLYDYESGSDDHVYEELRAATSGPEPSGRRASVRACASAAAVQPAA
RGRDRAAAAGTTVAAPAAAPARRSSSRASSRPPRAAADPPVLRPATRGSSGGAGAVAVGPPRPRAPPGAN
AVASGRPLAFSAAPKTPKAPWCGPTHAYNRTIFCEAVALVAAEYARQAAASVWDSDPPKSNERLDRMLKS
AAIRILVCEGSGLLAAANDILAARAQRPAARGSTSGGESRLRGERARP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Protection against a BHV-1 challenge was obtained in calves immunized with the plasmid encoding tgD-VP22 (UL49), as shown by significant reductions in viral excretion (Zheng et al., 2005).
- Related Vaccine(s):
Bovine herpesvirus 1 DNA vaccine tgD-VP22
|
7. US6 |
-
Gene Name :
US6
-
Sequence Strain (Species/Organism) :
Bovine alphaherpesvirus 1
-
VO ID :
VO_0011041
-
NCBI Gene ID :
1487406
-
NCBI Protein GI :
9629886
-
Locus Tag :
BoHV1_gp41
-
Genbank Accession :
KU198480
-
Protein Accession :
NP_045370
-
Taxonomy ID :
10320
-
Gene Starting Position :
118895
-
Gene Ending Position :
121435
-
Gene Strand (Orientation) :
+
-
Protein Name :
envelope glycoprotein D
-
Protein pI :
4.96
-
Protein Weight :
42542.47
-
Protein Length :
417
-
Protein Note :
envelope glycoprotein D; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; the nonessential glycoprotein gC interacts with cell surface proteoglycans, whereas the essential glycoprotein gD is involved in stable secondary attachment
-
DNA Sequence : Show Sequence
>NC_001847.1:118895-121435 Bovine herpesvirus 1, complete genome
CATGCAAGGGCCGACATTGGCCGTGCTGGGCGCGCTGCTCGCCGTTGCGGTGAGCTTGCCTACACCCGCG
CCGCGGGTGACGGTATACGTCGACCCGCCGGCGTACCCGATGCCGCGATACAACTACACTGAACGCTGGC
ACACTACCGGGCCCATACCGTCGCCCTTCGCAGACGGCCGCGAGCAGCCCGTCGAGGTGCGCTACGCGAC
GAGCGCGGCGGCGTGCGACATGCTGGCGCTGATCGCAGACCCGCAGGTGGGGCGCACGCTGTGGGAAGCG
GTACGCCGGCACGCGCGCGCGTACAACGCCACGGTCATATGGTACAAGATCGAGAGCGGGTGCGCCCGGC
CGCTGTACTACATGGAGTACACCGAGTGCGAGCCCAGGAAGCACTTTGGGTACTGCCGCTACCGCACACC
CCCGTTTTGGGACAGCTTCCTGGCGGGCTTCGCCTACCCCACGGACGACGAGCTGGGACTGATTATGGCG
GCGCCCGCGCGGCTCGTCGAGGGCCAGTACCGACGCGCGCTGTACATCGACGGCACGGTCGCCTATACAG
ATTTCATGGTTTCGCTGCCGGCCGGGGACTGCTGGTTCTCGAAACTCGGCGCGGCTCGCGGGTACACCTT
TGGCGCGTGCTTCCCGGCCCGGGATTACGAGCAAAAGAAGGTTCTGCGCCTGACGTATCTCACGCAGTAC
TACCCGCAGGAGGCACACAAGGCCATAGTCGACTACTGGTTCATGCGCCACGGGGGCGTCGTTCCGCCGT
ATTTTGAGGAGTCGAAGGGCTACGAGCCGCCGCCTGCCGCCGATGGGGGTTCCCCCGCGCCACCCGGCGA
CGACGAGGCCCGCGAGGATGAAGGGGAGACCGAGGACGGGGCAGCCGGGCGGGAGGGCAACGGCGGCCCC
CCAGGACCCGAAGGCGACGGCGAGAGTCAGACCCCCGAAGCCAACGGAGGCGCCGAGGGCGAGCCGAAAC
CCGGCCCCAGCCCCGACGCCGACCGCCCCGAAGGCTGGCCGAGCCTCGAAGCCATCACGCACCCCCCGCC
CGCCCCCGCTACGCCCGCGGCCCCCGACGCCGTGCCGGTCAGCGTCGGGATCGGCATTGCGGCTGCGGCG
ATCGCGTGCGTGGCCGCCGCCGCCGCCGGCGCGTACTTCGTCTATACGCGCCGGCGCGGTGCGGGTCCGC
TGCCCAGAAAGCCAAAAAAGCTGCCGGCCTTTGGCAACGTCAACTACAGCGCGCTGCCCGGGTGAGCGGC
CTAGGCCCTCCCCCGACCGCCCCCTTTGCTCCTAGCCCCGGCTCCTGCCGAGCCGCGCGGGGCGGGAGAT
AAAGCGCCCGCGCGTCGGCGACTCAAGCCATTGCCGCGACCTTGTCCTCCGGCGCGCTCGCGATGCGGTG
CCTGTTGCTCTGGATGGTGGTGCTGGCCGCGCGAGCGGCGCCCGCTCGCAGCCTTGTGTATCGCGGCGAG
GCAGTCGGCCTGCGCGCGGACGGCCCCGTAGCGTTCGCTGTCCACCCGACCGACGCAACGCTCGCGCTGC
GGGGCCGGCTGATTTTCCTGGAACACCAGCTCCCGGCCGGGCGGCGCTACAACGGGACCGTCGAGCTGCT
GCGCTACCACGCCGCGGGCGACTGCTTCGTTATGCTGCAGACGACCGCGTTCGCCTCCTGCCCGCGCGTC
GCGAACGACGCCTTTCGCTCCTGCCTGCACGCCGACACGCGCCCCGCTCGCAGCGAGCGGCGCGCGAGCG
CCGCGGTCGAAAACCACGTGCTCTTCTCCATCGCCCATCCGCGCCCAATAGACTCAGGGCTCTACTTTCT
GCGCGTCGGCATCTACGGCGGCACCGCGGGCAGCGAGCGCCGCCGAGACGTCTTTCCCTTGGCCGCGTTT
GTACACAGCTTCGGTGAGCCCGGAGACCCAGAGGCCGCGGCCGCGCACCCCGGCGCCGTCGAGGCAGTCG
CGACCCGCTGCGAGCGGGGCCTCGACGCCAGCTCGGCGAGCCTCTACGACCGCGCGCTGGCGGCGTTCCC
CGCAGGCGCCGCCACCACGCCCGGCCCCACCGCGAGCAGCGGGAGCGGGGCCGCGACGCCGGAGAGGGTC
GACGAGACGACGGAAGTCAAGGCCGCGACGAGAGCGGGCTCGGCGTTTGCCCTCACCACGCCCCCGGCCG
GCCTGACCGCCAGCCCCGCCGCCAGCCCCTCCCGTGCCTTTAGCGCGGCCGCCCCGGCCGCCGCTGCGCA
GCCGGCCGGAGACACGCCCGCTCGCTTCCGGCGCCAACTGGCGTCGATCCTAGTGCCTCTGTGCGTGCTG
GTGCTGCTGCTGCTTGCGCTCTGCGCCGCGACGGTAAACTGCGCGCTGCGCCGCCGCCTGCTGCCGTGCT
CTCGGCGCGTTTACAAGCCGCGGACGTGCGCGACATGCGGGAGCGGCACTTGCGCGGGGCGGCCCCCCTG
CCGCGGCGCGGCACCGAGCGCCCCAGCCACCGTCGTGGCACTGGGCTCCCGGCCAAAGGCGCCCCCCCTC
GCCACCATCAGCGAAGAATAA
-
Protein Sequence : Show Sequence
>NP_045370.1 envelope glycoprotein D [Bovine alphaherpesvirus 1]
MQGPTLAVLGALLAVAVSLPTPAPRVTVYVDPPAYPMPRYNYTERWHTTGPIPSPFADGREQPVEVRYAT
SAAACDMLALIADPQVGRTLWEAVRRHARAYNATVIWYKIESGCARPLYYMEYTECEPRKHFGYCRYRTP
PFWDSFLAGFAYPTDDELGLIMAAPARLVEGQYRRALYIDGTVAYTDFMVSLPAGDCWFSKLGAARGYTF
GACFPARDYEQKKVLRLTYLTQYYPQEAHKAIVDYWFMRHGGVVPPYFEESKGYEPPPAADGGSPAPPGD
DEAREDEGETEDGAAGREGNGGPPGPEGDGESQTPEANGGAEGEPKPGPSPDADRPEGWPSLEAITHPPP
APATPAAPDAVPVSVGIGIAAAAIACVAAAAAGAYFVYTRRRGAGPLPRKPKKLPAFGNVNYSALPG
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Calves were injected intranasally with either AdCMVgC or AdCMVgD (US6) or a combination of these two recombinants or a commercially available live vaccine for comparison. The highest BHV-1 neutralizing antibody titres were obtained with AdCMVgD (US6) followed by the live vaccine and to a lower extent with the combination of the two recombinants. Calves were protected against intranasal BHV-1 challenge performed 3 weeks after the second immunization (Gogev et al., 2002).
- Related Vaccine(s):
Bovine herpesvirus 1 DNA vaccine AdCMVgD
,
Bovine herpesvirus 1 DNA vaccine tgD-VP22
,
Bovine herpesvirus 1 recombinant vector vaccine rLaSota/gDF encoding gD
,
Bovine herpesvirus 1 recombinant vector vaccine rLaSota/gDFL encoding gD
|
8. US7 |
-
Gene Name :
US7
-
Sequence Strain (Species/Organism) :
Bovine alphaherpesvirus 1
-
VO ID :
VO_0011042
-
NCBI Gene ID :
4783432
-
NCBI Protein GI :
9629887
-
Locus Tag :
BoHV1_gp127
-
Genbank Accession :
KU198480
-
Protein Accession :
NP_045371
-
Taxonomy ID :
10320
-
Gene Starting Position :
120286
-
Gene Ending Position :
121435
-
Gene Strand (Orientation) :
+
-
Protein Name :
envelope glycoprotein I
-
Protein pI :
9.63
-
Protein Weight :
37115.17
-
Protein Length :
382
-
Protein Note :
gD family
-
DNA Sequence : Show Sequence
>NC_001847.1:120286-121435 Bovine herpesvirus 1, complete genome
GATGCGGTGCCTGTTGCTCTGGATGGTGGTGCTGGCCGCGCGAGCGGCGCCCGCTCGCAGCCTTGTGTAT
CGCGGCGAGGCAGTCGGCCTGCGCGCGGACGGCCCCGTAGCGTTCGCTGTCCACCCGACCGACGCAACGC
TCGCGCTGCGGGGCCGGCTGATTTTCCTGGAACACCAGCTCCCGGCCGGGCGGCGCTACAACGGGACCGT
CGAGCTGCTGCGCTACCACGCCGCGGGCGACTGCTTCGTTATGCTGCAGACGACCGCGTTCGCCTCCTGC
CCGCGCGTCGCGAACGACGCCTTTCGCTCCTGCCTGCACGCCGACACGCGCCCCGCTCGCAGCGAGCGGC
GCGCGAGCGCCGCGGTCGAAAACCACGTGCTCTTCTCCATCGCCCATCCGCGCCCAATAGACTCAGGGCT
CTACTTTCTGCGCGTCGGCATCTACGGCGGCACCGCGGGCAGCGAGCGCCGCCGAGACGTCTTTCCCTTG
GCCGCGTTTGTACACAGCTTCGGTGAGCCCGGAGACCCAGAGGCCGCGGCCGCGCACCCCGGCGCCGTCG
AGGCAGTCGCGACCCGCTGCGAGCGGGGCCTCGACGCCAGCTCGGCGAGCCTCTACGACCGCGCGCTGGC
GGCGTTCCCCGCAGGCGCCGCCACCACGCCCGGCCCCACCGCGAGCAGCGGGAGCGGGGCCGCGACGCCG
GAGAGGGTCGACGAGACGACGGAAGTCAAGGCCGCGACGAGAGCGGGCTCGGCGTTTGCCCTCACCACGC
CCCCGGCCGGCCTGACCGCCAGCCCCGCCGCCAGCCCCTCCCGTGCCTTTAGCGCGGCCGCCCCGGCCGC
CGCTGCGCAGCCGGCCGGAGACACGCCCGCTCGCTTCCGGCGCCAACTGGCGTCGATCCTAGTGCCTCTG
TGCGTGCTGGTGCTGCTGCTGCTTGCGCTCTGCGCCGCGACGGTAAACTGCGCGCTGCGCCGCCGCCTGC
TGCCGTGCTCTCGGCGCGTTTACAAGCCGCGGACGTGCGCGACATGCGGGAGCGGCACTTGCGCGGGGCG
GCCCCCCTGCCGCGGCGCGGCACCGAGCGCCCCAGCCACCGTCGTGGCACTGGGCTCCCGGCCAAAGGCG
CCCCCCCTCGCCACCATCAGCGAAGAATAA
-
Protein Sequence : Show Sequence
>NP_045371.1 envelope glycoprotein I [Bovine alphaherpesvirus 1]
MRCLLLWMVVLAARAAPARSLVYRGEAVGLRADGPVAFAVHPTDATLALRGRLIFLEHQLPAGRRYNGTV
ELLRYHAAGDCFVMLQTTAFASCPRVANDAFRSCLHADTRPARSERRASAAVENHVLFSIAHPRPIDSGL
YFLRVGIYGGTAGSERRRDVFPLAAFVHSFGEPGDPEAAAAHPGAVEAVATRCERGLDASSASLYDRALA
AFPAGAATTPGPTASSGSGAATPERVDETTEVKAATRAGSAFALTTPPAGLTASPAASPSRAFSAAAPAA
AAQPAGDTPARFRRQLASILVPLCVLVLLLLALCAATVNCALRRRLLPCSRRVYKPRTCATCGSGTCAGR
PPCRGAAPSAPATVVALGSRPKAPPLATISEE
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Immunization of calves with truncated gpI (US7) protein induced gpI-specific nasal IgA, IgG1, serum neutralizing antibodies and gpI-specific peripheral lymphocyte proliferation. All immunized calves were protected from clinical disease after BHV-1 challenge. Further, nine of ten immunized calves had no intranasal viral shedding (Gao et al., 1994).
- Related Vaccine(s):
Bovine herpesvirus 1 GPI protein vaccine
|
9. US8 |
-
Gene Name :
US8
-
Sequence Strain (Species/Organism) :
Bovine herpesvirus 1
-
NCBI Gene ID :
1487407
-
NCBI Protein GI :
9629888
-
Locus Tag :
BoHV1_gp42
-
Genbank Accession :
AJ004801
-
Protein Accession :
NP_045372
-
Taxonomy ID :
10320
-
Gene Starting Position :
121713
-
Gene Ending Position :
123505
-
Gene Strand (Orientation) :
+
-
Protein Name :
envelope glycoprotein E
-
Protein pI :
4.53
-
Protein Weight :
56945.75
-
Protein Length :
575
-
Protein Note :
envelope glycoprotein E; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; envelope glycoprotein E and glycoprotein I form a heterodimer that play important roles in virus cell-to-cell spread
-
DNA Sequence : Show Sequence
>gi|9629818:121713-123505 Bovine herpesvirus 1, complete genome
AATGCAACCCACCGCGCCGCCCCGGCGGCGGTTGCTGCCGCTGCTGCTGCCGCAGTTATTGCTTTTCGGG
CTGATGGCCGAGGCCAAGCCCGCGACCGAAACCCCGGGCTCGGCTTCGGTCGACACGGTCTTCACGGCGC
GCGCTGGCGCGCCCGTCTTTCTCCCAGGGCCCGCGGCGCGCCCGGACGTGCGCGCCGTTCGCGGCTGGAG
CGTCCTCGCGGGCGCCTGCTCGCCGCCCGTGCCGGAGCCCGTCTGCCTCGACGACCGCGAGTGCTTCACC
GACGTGGCCCTGGACGCGGCCTGCCTGCGAACCGCCCGCGTGGCCCCGCTGGCCATCGCGGAGCTCGCCG
AGCGGCCCGACTCAACGGGCGACAAAGAGTTTGTTCTCGCCGACCCGCACGTCTCGGCGCAGCTGGGTCG
CAACGCGACCGGGGTGCTGATCGCGGCCGCAGCCGAGGAGGACGGCGGCGTGTACTTCCTGTACGACCGG
CTCATCGGCGACGCCGGCGACGAGGAGACGCAGTTGGCGCTGACGCTGCAGGTCGCGACGGCCGGCGCGC
AGGGCGCCGCGCGGGACGAGGAGAGGGAACCAGCGACCGGGCCCACCCCCGGCCCGCCGCCCCACCGCAC
GACGACACGCGCGCCCCCGCGGCGGCACGGCGCGCGCTTCCGCGTGCTGCCGTACCACTCCCACGTATAC
ACCCCGGGCGATTCCTTTCTGCTATCGGTGCGTCTGCAGTCTGAGTTTTTCGACGAGGCTCCCTTCTCGG
CCAGCATCGACTGGTACTTCCTGCGGACGGCCGGCGACTGCGCGCTCATCCGCATATACGAGACGTGCAT
CTTCCACCCCGAGGCACCGGCCTGCCTGCACCCCGCCGACGCGCAGTGCAGCTTCGCGTCGCCGTACCGC
TCCGAGACCGTGTACAGCCGGCTGTACGAGCAGTGCCGCCCGGACCCTGCCGGTCGCTGGCCGCACGAGT
GCGAGGGCGCCGCGTACGCGGCGCCCGTTGCGCACCTGCGTCCCGCCAATAACAGCGTAGACCTGGTCTT
TGACGACGCGCCGGCTGCGGCCTCCGGGCTTTACGTCTTTGTGCTGCAGTACAACGGCCACGTGGAAGCT
TGGGACTACAGCCTAGTCGTTACTTCGGACCGTTTGGTGCGCGCGGTCACCGACCACACGCGCCCCGAGG
CCGCAGCCGCCGACGCTCCCGAGCCAGGCCCACCGCTCACCAGCGAGCCGGCGGGCGCGCCCACCGGGCC
CGCGCCCTGGCTTGTGGTGCTGGTGGGCGCGCTTGGACTCGCGGGACTGGTGGGCATCGCAGCCCTCGCC
GTTCGGGTGTGCGCGCGCCGCGCAAGCCAGAAGCGCACCTACGACATCCTCAACCCCTTCGGGCCCGTAT
ACACCAGCTTGCCGACCAACGAGCCGCTCGACGTGGTGGTGCCAGTTAGCGACGACGAATTTTCCCTCGA
CGAAGACTCTTTTGCGGATGACGACAGCGACGATGACGGGCCCGCTAGCAACCCCCCTGCGGATGCCTAC
GACCTCGCCGGCGCCCCAGAGCCAACTAGCGGGTTTGCGCGAGCCCCCGCCAACGGCACGCGCTCGAGTC
GCTCTGGGTTCAAAGTTTGGTTTAGGGACCCGCTTGAAGACGATGCCGCGCCAGCGCGGACCCCGGCCGC
ACCAGATTACACCGTGGTAGCAGCGCGACTCAAGTCCATCCTCCGCTAGGCGCCCCCCCCCCCGCGCGCT
GTGCCGTCTGACGGAAAGCACCCGCGTGTAGGGCTGCATATAA
-
Protein Sequence : Show Sequence
>gi|9629888|ref|NP_045372.1| envelope glycoprotein E [Bovine herpesvirus 1]
MQPTAPPRRRLLPLLLPQLLLFGLMAEAKPATETPGSASVDTVFTARAGAPVFLPGPAARPDVRAVRGWS
VLAGACSPPVPEPVCLDDRECFTDVALDAACLRTARVAPLAIAELAERPDSTGDKEFVLADPHVSAQLGR
NATGVLIAAAAEEDGGVYFLYDRLIGDAGDEETQLALTLQVATAGAQGAARDEEREPATGPTPGPPPHRT
TTRAPPRRHGARFRVLPYHSHVYTPGDSFLLSVRLQSEFFDEAPFSASIDWYFLRTAGDCALIRIYETCI
FHPEAPACLHPADAQCSFASPYRSETVYSRLYEQCRPDPAGRWPHECEGAAYAAPVAHLRPANNSVDLVF
DDAPAAASGLYVFVLQYNGHVEAWDYSLVVTSDRLVRAVTDHTRPEAAAADAPEPGPPLTSEPAGAPTGP
APWLVVLVGALGLAGLVGIAALAVRVCARRASQKRTYDILNPFGPVYTSLPTNEPLDVVVPVSDDEFSLD
EDSFADDDSDDDGPASNPPADAYDLAGAPEPTSGFARAPANGTRSSRSGFKVWFRDPLEDDAAPARTPAA
PDYTVVAARLKSILR
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
A gE-negative (US8-negative) strain was used as whole-virus antigen in an inactivated virus vaccine. Calves given the vaccine with the highest antigen concentration were adequately protected against challenge; clinical symptoms were virtually absent and challenge virus shedding was significantly reduced as compared with unvaccinated calves (Kaashoek et al., 1995).
-
Additional Molecule Role :
Virmugen
-
Additional Molecule Role Annotation :
A deletion of BHV-1 gE gene in strain A is considered as a live attenuated vaccine. After challenge, vaccinated calves were protected against disease and virus shedding was reduced (Kaashoek et al., 1994).
- Related Vaccine(s):
Bovine herpesvirus 1 US8 (gE) mutant vaccine
|
III. Vaccine Information |
|
|
|
|
|
|
1. BHV1 gD subunit vaccine |
a. Vaccine Ontology ID: |
VO_0004225 |
b. Type: |
Subunit vaccine |
c. Status: |
Research |
d. Antigen |
25 μg of vaccinia recombinant gD (van et al., 1997). |
e. Adjuvant: |
|
f. Immunization Route |
Intramuscular injection (i.m.) |
g.
Cattle Response |
- Vaccination Protocol:
Calves were randomly allocated to one of five vaccine groups and immunized with either 25 μg of gD in avridine, 25 μg tgD in avridine, commercial KV, commercial MLV or avridine. All vaccines were administered intramuscularly. 3 weeks after primary immunization the calves were re-immunized (van et al., 1997).
- Immune Response:
All vaccinated calves had significantly (P<0.05) higher serum neutralizing antibody titers prechallenge than the control animals. Calves immunized with the experimental gD or tgD vaccines had significantly (P<0.05) higher antibody titers than animals immunized with KV or MLV vaccines (van et al., 1997).
- Challenge Protocol:
Calves were challenged 4 weeks after secondary immunization with BHV1. Each calf was exposed for 4 minutes to an aerosol of 10^7 p.f.u. ml- ’ of BHVl strain 108 (van et al., 1997).
- Efficacy:
All vaccinated calves had a significantly lower (P<0.05) rectal temperature and sick score than the placebo group. In contrast to the placebo-, KV- and MLV-immunized groups, the gD- and tgD-immunized groups experienced minimal weight loss during the period following challenge. The gD- and tgD-vaccinated calves shed significantly (P<0.05) lower amounts of virus than the placebo or KV-immunized groups throughout the follow-up period. In the gD and tgD subunit vaccine vaccinated groups only one out of eight animals shed virus (van et al., 1997).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Bovilis IBR Marker |
a. Tradename: |
Bovilis IBR Marker |
b. Manufacturer: |
Intervet |
c. Vaccine Ontology ID: |
VO_0000979 |
d. Type: |
Live, attenuated vaccine |
e. Status: |
Licensed |
f. Host Species for Licensed Use: |
Cattle |
g. Immunization Route |
Intramuscular injection (i.m.) |
h. Description |
Live or inactivated gE-deleted marker vaccine(van et al., 1996) |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Bovine herpesvirus 1 DNA vaccine AdCMVgC |
a. Vaccine Ontology ID: |
VO_0011382 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Antigen |
Bovine herpesvirus 1 glycoprotein C |
e. Gene Engineering of
UL44 |
- Type:
DNA vaccine construction
- Description:
For the gC gene, a SpeI–NotI fragment (containing the gC gene) was extracted from pSKgC and cloned into pCi to yield plasmid pCigC. The expression cassettes containing the CMV promoter, splicing signals, glycoprotein gene, and SV40 polyadenylation signal, were extracted as BamHI–BglII fragments that were cloned into the BamHI site of plasmid pAd-link, resulting in plasmid pAdCMVgC (Gogev et al., 2002).
- Detailed Gene Information: Click here.
|
f. Vector: |
pCi (Promega) |
g. Immunization Route |
Intranasal |
h.
Cattle Response |
- Vaccination Protocol:
Twenty-eight calves, 6–8 months old, were randomly allocated into five groups of five calves and one group of three calves. Three groups were inoculated twice 3 weeks apart by the intranasal route with 2 ml per nostril with a semi-purified preparation at a dose of 1010 CCID50 (Cell Culture Infectious Dose) of either AdCMVgC, or AdCMVgD or a combination of these two recombinants (5×10^9 CCID50 of AdCMVgC+5×10^9 CCID50 of AdCMVgD). At days 0 and 21, one group was inoculated twice by the intranasal route with a commercially available live vaccine whereas the group of three animals was inoculated intranasally twice 3 weeks apart with inactivated AdCMVgD, inactivated AdCMVgC, and a combination of them. One group was not inoculated and served as control (Gogev et al., 2002).
- Challenge Protocol:
On day 42, calves were challenged by the intranasal route with 5×10^6 plaque forming units (PFU) of BHV-1 IOWA strain. Calves were clinically examined and rectal temperatures were measured for 2 weeks after each immunization and for 3 weeks following the challenge performed on day 42 (Gogev et al., 2002).
- Efficacy:
The administration of either Ad5CMVgD or Ad5CMVgC, or a combination of them in calves by intranasal route 3 weeks apart, induced BHV-1 neutralizing antibody responses and conferred protection against challenge with BHV-1 Iowa strain (Gogev et al., 2002).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Bovine herpesvirus 1 DNA vaccine AdCMVgD |
a. Vaccine Ontology ID: |
VO_0011381 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Antigen |
Bovine herpesvirus 1 glycoprotein D |
e. Gene Engineering of
US6 |
- Type:
DNA vaccine construction
- Description:
For the gD gene, a NheI–NotI fragment (containing the gD gene) was extracted from pGEMgD and cloned into pCi to yield plasmid pCigD. The expression cassettes containing the CMV promoter, splicing signals, glycoprotein gene, and SV40 polyadenylation signal, were extracted as BamHI–BglII fragments that were cloned into the BamHI site of plasmid pAd-link, resulting in plasmid pAdCMVgD (Gogev et al., 2002).
- Detailed Gene Information: Click here.
|
f. Vector: |
pCi (Promega) |
g. Immunization Route |
Intranasal |
h.
Cattle Response |
- Vaccination Protocol:
Twenty-eight calves, 6–8 months old, were randomly allocated into five groups of five calves and one group of three calves. Three groups were inoculated twice 3 weeks apart by the intranasal route with 2 ml per nostril with a semi-purified preparation at a dose of 10^10 CCID50 (Cell Culture Infectious Dose) of either AdCMVgC, or AdCMVgD or a combination of these two recombinants (5×10^9 CCID50 of AdCMVgC+5×10^9 CCID50 of AdCMVgD). At days 0 and 21, one group was inoculated twice by the intranasal route with a commercially available live vaccine whereas the group of three animals was inoculated intranasally twice 3 weeks apart with inactivated AdCMVgD, inactivated AdCMVgC, and a combination of them. One group was not inoculated and served as control (Gogev et al., 2002).
- Challenge Protocol:
On day 42, calves were challenged by the intranasal route with 5×10^6 plaque forming units (PFU) of BHV-1 IOWA strain. Calves were clinically examined and rectal temperatures were measured for 2 weeks after each immunization and for 3 weeks following the challenge performed on day 42 (Gogev et al., 2002).
- Efficacy:
The administration of either Ad5CMVgD or Ad5CMVgC, or a combination of them in calves by intranasal route 3 weeks apart, induced BHV-1 neutralizing antibody responses and conferred protection against challenge with BHV-1 Iowa strain (Gogev et al., 2002).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Bovine herpesvirus 1 DNA vaccine pMASIAtgB encoding a truncated, secreted form of gB |
a. Vaccine Ontology ID: |
VO_0004317 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Mice, calves |
e. Gene Engineering of
gB |
- Type:
DNA vaccine construction
- Description:
Vector pMASIA expressed truncated, secreted form of BHV-1 gB (Huang et al., 2005).
- Detailed Gene Information: Click here.
|
f. Vector: |
pMASIA (Huang et al., 2005) |
g. Immunization Route |
Intraperitoneal injection (i.p.) |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0000286
- Immune Response:
pMASIAtgB elicited both humoral responses and activated gamma interferon-secreting CD8+ CTLs, suggesting that a DNA vaccine expressing tgB induces a CTL response in the natural host of BHV-1 (Huang et al., 2005).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Bovine herpesvirus 1 DNA vaccine pRSV-gC |
a. Vaccine Ontology ID: |
VO_0011557 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Antigen |
Bovine herpesvirus 1 glycoprotein C |
e. Gene Engineering of
UL44 |
- Type:
DNA vaccine construction
- Description:
The complete coding sequence of the gene for gC was excised from a recombinant plasmid containing HindIII ‘I’ fragment of BHV-1 DNA (Gupta et al., 1995). The 2.4 kb BamHI and EcoRI double digested DNA fragment containing gC gene of BHV-1 was subcloned into a pRSV vector. The recombinant plasmid (pRSV-gC) encoding gC under the control of a RSV promoter/enhancer yielded high levels of BHV-1 gC expression in transfected cell (Gupta et al., 1998). Plasmid DNA was prepared from Escherichia coli bacterial cultures by the alkali lysis method and passed over Qiagen plasmid purification columns (Qiagen, CA). The isolated plasmid was ethanol-precipitated and dissolved in 0.85% saline at a concentration of 0.5 mg/ml (Gupta et al., 2001).
- Detailed Gene Information: Click here.
|
f. Vector: |
pRSV containing a RSV promoter/enhancer |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Cattle Response |
- Vaccination Protocol:
Three calves were inoculated intramuscular (i.m.) six times with 500 μg of pRSV-gC and two calves were inoculated i.d. six times with 250 μg of pRSV-gC at each immunization. One calf received saline at each immunization and served as unvaccinated control. All inoculations were done at monthly intervals (Gupta et al., 2001).
- Challenge Protocol:
All calves were exposed to BHV-1 (108.5 TCID50) by intranasal aerosol installation 1 month after last injection. All calves were examined daily for clinical symptoms of the disease. Nasal swabs were collected before challenge and 1, 3, 5, 7, 9 and 11 days post-challenge for isolation of shedding virus (Gupta et al., 2001).
- Efficacy:
Results indicate that DNA immunization with gC could induce neutralizing antibody and lymphoproliferative responses with BHV-1 responsive memory B cells in bovines. However, the immunity developed sufficient for only partial protection against BHV-1 challenge (Gupta et al., 2001).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Bovine herpesvirus 1 DNA vaccine pRSVgIV |
a. Vaccine Ontology ID: |
VO_0004315 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Mouse, calf |
e. Gene Engineering of
gIV |
- Type:
DNA vaccine construction
- Description:
Vector pRSV expressed BHV-1 glycoprotein I (gIV) (Cox et al., 1993).
- Detailed Gene Information: Click here.
|
f. Vector: |
pRSV (Cox et al., 1993) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
Clinical symptoms including fever, nasal mucosal lesions, and inappetence were reduced in all pRSVgIV-injected calves compared with the pRSVO-injected calf (control). Increases in gIV-specific antibody titers were observed at day 6 post challenge and continued to the end of the experiment. By comparison with the titer achieved by the control calf after challenge, it is clear that all three pRSVgIV-injected calves were primed to respond to BHV-1 (Cox et al., 1993).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Bovine herpesvirus 1 DNA vaccine tgD-VP22 |
a. Vaccine Ontology ID: |
VO_0011554 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Antigen |
Bovine herpesvirus 1 tegument protein VP22 and glycoprotein D |
e. Gene Engineering of
UL49 |
- Type:
DNA vaccine construction
- Description:
Researchers constructed the plasmids pVP22-YFP, pMASIA-tgD-YFP, and pMASIA-tgD-VP22-YFP. For the construction of pVP22-YFP, the UL49 (VP22 gene) open reading frame was amplified from BHV-1 genomic DNA by PCR and then inserted into pEYFP-N1 (Clontech, BD Biosciences, Palo Alto, Calif.). Subsequently, pMASIA-tgD-YFP and pMASIA-tgD-VP22-YFP were generated by PCR cloning of the YFP and VP22-YFP genes from pEYFP-N1 and pVP22-YFP, respectively, into pMASIA-tgD, which encodes BHV-1 tgD (26). COS-7 cells were transfected with pMASIA-tgD-VP22-YFP, pMASIA-tgD-YFP, and pVP22-YFP and monitored every 4 h by fluorescence microscopy (Zheng et al., 2005).
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
US6 |
- Type:
DNA vaccine construction
- Description:
Researchers constructed the plasmids pVP22-YFP, pMASIA-tgD-YFP, and pMASIA-tgD-VP22-YFP. For the construction of pVP22-YFP, the UL49 (VP22 gene) open reading frame was amplified from BHV-1 genomic DNA by PCR and then inserted into pEYFP-N1 (Clontech, BD Biosciences, Palo Alto, Calif.). Subsequently, pMASIA-tgD-YFP and pMASIA-tgD-VP22-YFP were generated by PCR cloning of the YFP and VP22-YFP genes from pEYFP-N1 and pVP22-YFP, respectively, into pMASIA-tgD, which encodes BHV-1 tgD (26). COS-7 cells were transfected with pMASIA-tgD-VP22-YFP, pMASIA-tgD-YFP, and pVP22-YFP and monitored every 4 h by fluorescence microscopy (Zheng et al., 2005).
- Detailed Gene Information: Click here.
|
g. Vector: |
pMASIA-tgD (Zheng et al., 2005) |
h. Immunization Route |
Intradermal injection (i.d.) |
i.
Cattle Response |
- Vaccination Protocol:
Calves were immunized intradermally with 500 μg of pMASIA-tgD-VP22, 500 μg of pMASIA-tgD, or saline in a 500-μl volume by use of the Biojector 2000 needle-free injection system (Bioject, Bedminster, N.J.) (Zheng et al., 2005).
- Challenge Protocol:
All animals were reimmunized after 28 days and were challenged with BHV-1 strain 108 on day 54. All data from this study were analyzed with the aid of Graphpad Prism 3.0 (Zheng et al., 2005).
- Efficacy:
Protection against a BHV-1 challenge was obtained in calves immunized with the plasmid encoding tgD-VP22 (UL49), as shown by significant reductions in viral excretion (Zheng et al., 2005).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Bovine herpesvirus 1 GPI protein vaccine |
a. Vaccine Ontology ID: |
VO_0011383 |
b. Type: |
Subunit vaccine |
c. Status: |
Research |
d. Antigen |
Bovine herpesvirus 1 envelope glycoprotein I |
e. Gene Engineering of
US7 |
- Type:
Recombinant protein preparation
- Description:
A truncated BHV-1 envelope gpI protein was secreted into the culture supernatant of D17 cells transfected with the gpI gene lacking the coding sequence for the transmembrane region (TMR). The transmembrane domain is essential for gpI stability in the envelope, virus infectivity and, most probably, natural killer cell recognition (Gao et al., 1994).
- Detailed Gene Information: Click here.
|
f.
Cattle Response |
- Vaccination Protocol:
The 20 calves were divided into two groups (ten animals in each group) and immunized as follows:group 1 was primed intramusculary (i.m.) with concentrated gpI (17 ug/animal) emulsified in complete Freund's adjuvant, and boosted by intranasal (i.n.) aerosolization (Laboratory spray unit, Gelman Sciences Inc., Ann Arbor, MI) with 100yg gpI plus 20 ug cholera toxin subunit B (CTB) per animal at the 3rd and 9th weeks. Then, 30 yg of gpI emulsified in incomplete Freund's adjuvant was administered subcutaneously at the base of the ear at the 15th week. Alternatively, group 2 was treated as above with the same amount of non-transfected D17 cell culture supernatant concentrated from a volume equal to that of the gpI supernatant. The antibody levels in sera and nasal secretions were tested at 2-week intervals after each vaccination to assess the gpI immune response (Gao et al., 1994).
- Challenge Protocol:
All animals were challenged with 5 x 10^5 p.f.u, of virulent Cooper strain BHV-1 (ATCC VR864) by intranasal aerosolization. Nasal swabs were collected daily for 12 days and viral replication and shedding were detected by titration on MDBK cells. The animals were monitored for signs of disease (fever, nasal mucosal lesions, nasal discharge, conjunctivitis and depression) (Gao et al., 1994).
- Efficacy:
mmunization of calves with this truncated gpI protein induced gpI-specific nasal IgA, IgG1, serum neutralizing antibodies and gpI-specific peripheral lymphocyte proliferation. All immunized calves were protected from clinical disease after BHV-1 challenge. Further, nine of ten immunized calves had no intranasal viral shedding. One animal shed a minimal amount of virus following challenge, but produced no antibodies to other viral proteins as evidenced by immunoprecipitation of 35S-labelled viral proteins by sera from virus-challenged animals (Gao et al., 1994).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Bovine herpesvirus 1 recombinant vector vaccine BHVl/BRSVG |
a. Vaccine Ontology ID: |
VO_0004316 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Calves |
e. Gene Engineering of
G from BRSV |
- Type:
Recombinant vector construction
- Description:
Vector BHV1 expressed the G protein of bovine respiratory syncytial virus (Schrijver et al., 1997).
- Detailed Gene Information: Click here.
|
f. Vector: |
BHV1 (Schrijver et al., 1997) |
g. Immunization Route |
intranasal immunization |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
A gE-negative bovine herpesvirus 1 (BHV1) vector vaccine carrying a gene coding for the G protein of bovine respiratory syncytial virus (BRSV) (BHV1/BRSV-G) induced the same high degree of protection in calves against BRSV infection and BHV1 infection as a multivalent commercial vaccine (Schrijver et al., 1997).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Bovine herpesvirus 1 recombinant vector vaccine rLaSota/gDF encoding gD |
a. Vaccine Ontology ID: |
VO_0004319 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Calves |
e. Gene Engineering of
US6 |
- Type:
Recombinant vector construction
- Description:
Vector pLaSota expressed a chimeric gD in which the ectodomain of gD was fused with the transmembrane domain and cytoplasmic tail of the NDV fusion F glycoprotein (Khattar et al., 2010).
- Detailed Gene Information: Click here.
|
f. Vector: |
recombinant Newcastle Disease Virus pLaSota carrying the full-length antigenomic cDNA of the lentogenic NDV (Newcastle disease virus ) vaccine strain LaSota (Khattar et al., 2010) |
g. Immunization Route |
combined IN and IT routes |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
Following challenge with BHV-1, calves immunized with the recombinant NDVs had lower titers and earlier clearance of challenge virus compared to the empty vector control. Partial protection was observed (Khattar et al., 2010).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Bovine herpesvirus 1 recombinant vector vaccine rLaSota/gDFL encoding gD |
a. Vaccine Ontology ID: |
VO_0004318 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Calves |
e. Gene Engineering of
US6 |
- Type:
Recombinant vector construction
- Description:
Vector pLaSota expressed gD without any modification (Khattar et al., 2010).
- Detailed Gene Information: Click here.
|
f. Vector: |
recombinant Newcastle Disease Virus pLaSota carrying the full-length antigenomic cDNA of the lentogenic NDV(Newcastle disease virus ) vaccine strain LaSota (Khattar et al., 2010) |
g. Immunization Route |
combined IN and IT routes |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
Following challenge with BHV-1, calves immunized with the recombinant NDVs had lower titers and earlier clearance of challenge virus compared to the empty vector control, and reduced disease was observed with rLaSota/gDFL. Partial protection was observed (Khattar et al., 2010).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Bovine herpesvirus 1 UL23 mutant vaccine |
a. Product Name: |
B8-D53 |
b. Vaccine Ontology ID: |
VO_0002949 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Research |
e. Host Species as Laboratory Animal Model: |
Cow |
f. Gene Engineering of
UL23 |
- Type:
Gene mutation
- Description:
This UL23 mutant is from Bovine herpesvirus 1 (Kit et al., 1985).
- Detailed Gene Information: Click here.
|
g. Immunization Route |
intranasal immunization |
h.
Cattle Response |
- Persistence:
A UL23 mutant is attenuated in calves (Kit et al., 1985).
- Efficacy:
A UL23 mutant induced protection in calves from challenge with wild type BHV-1 (Kit et al., 1985).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Bovine herpesvirus 1 US8 (gE) mutant vaccine |
a. Vaccine Ontology ID: |
VO_0002950 |
b. Type: |
Live, attenuated vaccine |
c. Status: |
Research |
d. Gene Engineering of
US8 |
- Type:
Gene mutation
- Description:
- Detailed Gene Information: Click here.
|
e. Preparation |
The bovine herpesvirus 1 (BHV1) strain Za is a conventionally attenuated strain with a 2.7 kb deletion that encompasses the complete coding region for glycoprotein E (gE) (Kaashoek et al., 1995). |
f. Immunization Route |
intranasal immunization |
g.
Cattle Response |
- Persistence:
The bovine herpesvirus 1 (BHV1) strain Za is a conventionally attenuated strain with a 2.7 kb deletion that encompasses the complete coding region for glycoprotein E (gE) (Kaashoek et al., 1995).
- Efficacy:
Calves given the vaccine with the highest antigen concentration were ad.equately protected against challenge; clinical symptoms were virtually absent and challenge virus shedding was significantly reduced as compared with unvaccinated calves (Kaashoek et al., 1995)
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Bovine Rhinotracheitis Killed Virus Vaccine (USDA: 1105.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001561 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001877 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001878 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001879 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.00) |
a. Manufacturer: |
Wyeth, Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001562 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation, Texas Vet Lab, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001563 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001564 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001565 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Bovine Rhinotracheitis Modified Live Virus Vaccine (USDA: 1101.B0) |
a. Manufacturer: |
SolidTech Animal Health, Inc. |
b. Vaccine Ontology ID: |
VO_0001566 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4019.00) |
a. Manufacturer: |
Wyeth, Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001880 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4059.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001881 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4069.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001882 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001883 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001884 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001885 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001886 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation, Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001887 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001888 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
33. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001889 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
34. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1121.31) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001890 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
35. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 4139.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001891 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
36. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4129.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001892 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
37. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4179.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001893 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4209.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001894 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
39. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001895 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
40. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.20) |
a. Manufacturer: |
Wyeth, Pfizer, Inc., Heska Corporation, Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001896 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
41. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001897 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
42. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001898 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
43. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001899 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
44. Bovine Rhinotracheitis-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11B5.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001900 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
45. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.20) |
a. Manufacturer: |
Heska Corporation, Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001901 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
46. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001902 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
47. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001903 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
48. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001904 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
49. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001905 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
50. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001906 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
51. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001907 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
52. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001908 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
53. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001909 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
54. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation, Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001910 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
55. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.22) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001911 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
56. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001912 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
57. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001913 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
58. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001914 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
59. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001915 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
60. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001916 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
61. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001917 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
62. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001918 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
63. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001919 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
64. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001920 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
65. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine (USDA: 1175.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001921 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
66. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001922 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
67. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.00) |
a. Manufacturer: |
Wyeth, Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001923 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
68. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.20) |
a. Manufacturer: |
Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001924 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
69. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.22) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001925 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
70. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001926 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
71. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001927 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
72. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001928 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
73. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.27) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001929 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
74. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.30) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001930 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
75. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001931 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
76. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001932 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
77. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001933 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
78. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001934 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
79. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20) |
a. Manufacturer: |
Wyeth, Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001935 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
80. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001936 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
81. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001937 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
82. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001938 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
83. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.00) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001939 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
84. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation, Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001940 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
85. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001941 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
86. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.22) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001942 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
87. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001943 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
88. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001944 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
89. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001945 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
90. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.26) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001946 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
91. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.28) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001947 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
92. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.30) |
a. Manufacturer: |
Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001948 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
93. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001949 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
94. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001950 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
95. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001951 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
96. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001952 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
97. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001953 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
98. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001954 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
99. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001955 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
100. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001956 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
101. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C7.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001957 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
102. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44D5.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001958 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
103. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001959 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
104. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001960 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
105. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001961 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
106. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001962 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
107. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001963 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
108. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001964 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
109. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001965 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
110. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001966 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
111. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001967 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
112. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001968 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
113. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.21) |
a. Manufacturer: |
Wyeth, Pfizer, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001969 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
114. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.22) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001970 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
115. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001971 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
116. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001972 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
117. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001973 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
118. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001974 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
119. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001975 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
120. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001976 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
121. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44F9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001977 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
122. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001978 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
123. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001979 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
124. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001980 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
125. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001981 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
126. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001982 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
127. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001983 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
128. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001984 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
129. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001985 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
130. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001986 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
131. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001987 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
132. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001988 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
133. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001989 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
134. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001990 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
135. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001991 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
136. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001992 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
137. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001993 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
138. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001994 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
139. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001995 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
140. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001996 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
141. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001997 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
142. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001998 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
143. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001999 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
144. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002000 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
145. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002001 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
146. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002002 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
147. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002003 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
148. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002004 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
149. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002005 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
150. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002006 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
151. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002007 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
152. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002008 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
153. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11A5.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002009 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
154. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002010 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
155. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002011 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
156. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002012 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
157. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002013 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
158. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002014 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
159. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002015 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
IV. References |
1. Babiuk et al., 1987: Babiuk LA, L'Italien J, van Drunen Littel-van den Hurk S, Zamb T, Lawman JP, Hughes G, Gifford GA. Protection of cattle from bovine herpesvirus type I (BHV-1) infection by immunization with individual viral glycoproteins. Virology. 1987; 159(1); 57-66. [PubMed: 3037783].
2. Caselli et al., 2005: Caselli E, Boni M, Di Luca D, Salvatori D, Vita A, Cassai E. A combined bovine herpesvirus 1 gB-gD DNA vaccine induces immune response in mice. Comparative immunology, microbiology and infectious diseases. 2005; 28(2); 155-166. [PubMed: 15582691].
3. Castrucci et al., 2004: Castrucci G, Ferrari M, Marchini C, Salvatori D, Provinciali M, Tosini A, Petrini S, Sardonini Q, Lo Dico M, Frigeri F, Amici A. Immunization against bovine herpesvirus-1 infection. Preliminary tests in calves with a DNA vaccine. Comparative immunology, microbiology and infectious diseases. 2004; 27(3); 171-179. [PubMed: 15001312].
4. Cox et al., 1993: Cox GJ, Zamb TJ, Babiuk LA. Bovine herpesvirus 1: immune responses in mice and cattle injected with plasmid DNA. Journal of virology. 1993; 67(9); 5664-5667. [PubMed: 8350420].
5. Deshpande et al., 2002: Deshpande MS, Ambagala TC, Hegde NR, Hariharan MJ, Navaratnam M, Srikumaran S. Induction of cytotoxic T-lymphocytes specific for bovine herpesvirus-1 by DNA immunization. Vaccine. 2002; 20(31-32); 3744-3751. [PubMed: 12399204].
6. Gao et al., 1994: Gao Y, Leary TP, Eskra L, Splitter GA. Truncated bovine herpesvirus-1 glycoprotein I (gpI) initiates a protective local immune response in its natural host. Vaccine. 1994; 12(2); 145-152. [PubMed: 8147097].
7. Gogev et al., 2002: Gogev S, Vanderheijden N, Lemaire M, Schynts F, D'Offay J, Deprez I, Adam M, Eloit M, Thiry E. Induction of protective immunity to bovine herpesvirus type 1 in cattle by intranasal administration of replication-defective human adenovirus type 5 expressing glycoprotein gC or gD. Vaccine. 2002; 20(9-10); 1451-1465. [PubMed: 11818166].
8. Gupta et al., 2001: Gupta PK, Saini M, Gupta LK, Rao VD, Bandyopadhyay SK, Butchaiah G, Garg GK, Garg SK. Induction of immune responses in cattle with a DNA vaccine encoding glycoprotein C of bovine herpesvirus-1. Veterinary microbiology. 2001; 78(4); 293-305. [PubMed: 11182496].
9. Huang et al., 2005: Huang Y, Babiuk LA, van Drunen Littel-van den Hurk S. Immunization with a bovine herpesvirus 1 glycoprotein B DNA vaccine induces cytotoxic T-lymphocyte responses in mice and cattle. The Journal of general virology. 2005; 86(Pt 4); 887-898. [PubMed: 15784883].
10. Kaashoek et al., 1994: Kaashoek MJ, Moerman A, Madić J, Rijsewijk FA, Quak J, Gielkens AL, van Oirschot JT. A conventionally attenuated glycoprotein E-negative strain of bovine herpesvirus type 1 is an efficacious and safe vaccine. Vaccine. 1994; 12(5); 439-444. [PubMed: 8023552].
11. Kaashoek et al., 1995: Kaashoek MJ, Moerman A, Madić J, Weerdmeester K, Maris-Veldhuis M, Rijsewijk FA, van Oirschot JT. An inactivated vaccine based on a glycoprotein E-negative strain of bovine herpesvirus 1 induces protective immunity and allows serological differentiation. Vaccine. 1995; 13(4); 342-346. [PubMed: 7793128].
12. Kaashoek et al., 1998: Kaashoek MJ, Rijsewijk FA, Ruuls RC, Keil GM, Thiry E, Pastoret PP, Van Oirschot JT. Virulence, immunogenicity and reactivation of bovine herpesvirus 1 mutants with a deletion in the gC, gG, gI, gE, or in both the gI and gE gene. Vaccine. 1998; 16(8); 802-809. [PubMed: 9627937].
13. Khattar et al., 2010: Khattar SK, Collins PL, Samal SK. Immunization of cattle with recombinant Newcastle disease virus expressing bovine herpesvirus-1 (BHV-1) glycoprotein D induces mucosal and serum antibody responses and provides partial protection against BHV-1. Vaccine. 2010; 28(18); 3159-3170. [PubMed: 20189484].
14. Kit et al., 1985: Kit S, Qavi H, Gaines JD, Billingsley P, McConnell S. Thymidine kinase-negative bovine herpesvirus type 1 mutant is stable and highly attenuated in calves. Archives of virology. 1985; 86(1-2); 63-83. [PubMed: 2994602].
15. Langellotti et al., 2011: Langellotti CA, Pappalardo JS, Quattrocchi V, Mongini C, Zamorano P. Induction of specific cytotoxic activity for bovine herpesvirus-1 by DNA immunization with different adjuvants. Antiviral research. 2011; 90(3); 134-142. [PubMed: 21443903].
16. Petrini et al., 2011: Petrini S, Ramadori G, Corradi A, Borghetti P, Lombardi G, Villa R, Bottarelli E, Guercio A, Amici A, Ferrari M. Evaluation of safety and efficacy of DNA vaccines against bovine herpesvirus-1 (BoHV-1) in calves. Comparative immunology, microbiology and infectious diseases. 2011; 34(1); 3-10. [PubMed: 19906427].
17. Pontarollo et al., 2002: Pontarollo RA, Babiuk LA, Hecker R, Van Drunen Littel-Van Den Hurk S. Augmentation of cellular immune responses to bovine herpesvirus-1 glycoprotein D by vaccination with CpG-enhanced plasmid vectors. The Journal of general virology. 2002; 83(Pt 12); 2973-2981. [PubMed: 12466473].
18. Schrijver et al., 1997: Schrijver RS, Langedijk JP, Keil GM, Middel WG, Maris-Veldhuis M, Van Oirschot JT, Rijsewijk FA. Immunization of cattle with a BHV1 vector vaccine or a DNA vaccine both coding for the G protein of BRSV. Vaccine. 1997; 15(17-18); 1908-1916. [PubMed: 9413101].
19. van et al., 1996: van Oirschot JT, Kaashoek MJ, Rijsewijk FA. Advances in the development and evaluation of bovine herpesvirus 1 vaccines. Veterinary microbiology. 1996; 53(1-2); 43-54. [PubMed: 9010997].
20. van et al., 1997: van Drunen Littel-van den Hurk S, Tikoo SK, van den Hurk JV, Babiuk LA, Van Donkersgoed J. Protective immunity in cattle following vaccination with conventional and marker bovine herpesvirus-1 (BHV1) vaccines. Vaccine. 1997; 15(1); 36-44. [PubMed: 9041664].
21. Wiki: Bovine herpesvirus 1: Bovine herpesvirus 1 [http://en.wikipedia.org/wiki/Bovine_herpesvirus_1]
22. Zheng et al., 2005: Zheng C, Babiuk LA, van Drunen Littel-van den Hurk S. Bovine herpesvirus 1 VP22 enhances the efficacy of a DNA vaccine in cattle. Journal of virology. 2005; 79(3); 1948-1953. [PubMed: 15650221].
|