Hepatitis D virus |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Introduction
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- p27
(Protective antigen)
- Vaccine Information
- Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
12475 |
|
2. Introduction |
| HDV is found only in people who have Hepatitis B virus. It may make symptoms of hepatitis B worse or may cause symptoms in people who carry hepatitis B virus but have never displayed symptoms (A.D.A.M. Medical Encyclopedia). |
|
3. Host Ranges and Animal Models |
| Humans (A.D.A.M. Medical Encyclopedia) |
| II. Vaccine Related Pathogen Genes |
|
1. p27 |
-
Gene Name :
p27
-
Sequence Strain (Species/Organism) :
Hepatitis delta virus
-
NCBI Protein GI :
226737605
-
Other Database IDs :
CDD:279813
-
Taxonomy ID :
261991
-
Gene Strand (Orientation) :
?
-
Protein Name :
Large delta antigen
-
Protein pI :
10.45
-
Protein Weight :
26158.73
-
Protein Length :
329
-
Protein Note :
L-HDAg; p27
-
Protein Sequence : Show Sequence
>sp|P0C6M5.1|LHDAG_HDVU2 RecName: Full=Large delta antigen; Short=L-HDAg; AltName: Full=p27; Flags: Precursor
MSRSESKKNRGGREEILEQWVGARKKLEELERDLRKIKKKIKKLEEENPWLGNIKGILGKKDREGEGAPP
AKRARADQMEVDSGPRKRPFRGEFTDKERRDHRRRKALENKRKQLSSGGKSLSKEEEEELRKLTEEDERR
ERRVAGPRVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFARTGEGLDVRGNQGFPWDILFPADPPFSPQS
CRPQ
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27 |
| a. Vaccine Ontology ID: |
| VO_0004529 |
| b. Type: |
| DNA vaccine |
| c. Status: |
| Research |
| d. Host Species as Laboratory Animal Model: |
| Woodchucks |
| e. Gene Engineering of
p27 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
| f. Vector: |
| pcDNA3 prime, Ad5/Ad5F35-vector boost (Fiedler et al., 2013) |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h.
Woodchuck Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
Immunization with DNA plasmid prime administered via gene gun and Ad5/Ad5F35-vector boost expressing HDAg conferred protection from HDV in WHV/HDV co-infection in 5 out of 7 immunized animals. The two animals with the breakthrough had a shorter HDV viremia as compared to the un-vaccinated controls (Fiedler et al., 2013)
|
|
|
|
 |
|
 |
|
|
| IV. References |
1. A.D.A.M. Medical Encyclopedia: Delta agent (Hepatitis D) [http://www.ncbi.nlm.nih.gov/pubmedhealth/PMH0001264/]
2. Fiedler et al., 2013: Fiedler M, Kosinska A, Schumann A, Brovko O, Walker A, Lu M, Johrden L, Mayer A, Wildner O, Roggendorf M. Prime/Boost Immunization with DNA and Adenoviral Vectors Protects from Hepatitis D Virus (HDV) Infection after Simultaneous Infection with HDV and Woodchuck Hepatitis Virus. Journal of virology. 2013; ; . [PubMed: 23637419].
|
