Mycobacterium marinum |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Introduction
- Vaccine Related Pathogen Genes
- fbpA
(Protective antigen)
- Vaccine Information
- M. marinum pCMV-85A
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
1781 |
2. Introduction |
Mycobacterium marinum is an atypical Mycobacterium species found in cold or warm, fresh or salted water. M marinum infection occurs following skin and soft-tissue injuries that are exposed to an aquatic environment or marine animals. The infection usually presents as a localized granuloma but can evolve into an ascending lymphangitis that resembles sporotrichosis or can spread to deeper tissues. M marinum is a pathogen classified in Runyon group 1 and is a photochromogen, meaning it produces pigment when cultured and exposed to light. Culture growth occurs over 7-14 days and is optimal at 32°C (Medscape - Mycobacterium marinum). |
II. Vaccine Related Pathogen Genes |
1. fbpA |
-
Gene Name :
fbpA
-
Sequence Strain (Species/Organism) :
Mycobacterium marinum
-
NCBI Protein GI :
13431282
-
Other Database IDs :
CDD:304388
-
Taxonomy ID :
1781
-
Gene Strand (Orientation) :
?
-
Protein Name :
Diacylglycerol acyltransferase/mycolyltransferase Ag85A
-
Protein pI :
7.43
-
Protein Weight :
18276.89
-
Protein Length :
422
-
Protein Note :
DGAT; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; Fibronectin-binding protein A; 85A; Ag85A; Fbps A
-
Protein Sequence : Show Sequence
>sp|Q9KH57.1|A85A_MYCMR RecName: Full=Diacylglycerol acyltransferase/mycolyltransferase Ag85A; Short=DGAT; AltName: Full=Acyl-CoA:diacylglycerol acyltransferase; AltName: Full=Antigen 85 complex A; Short=85A; Short=Ag85A; AltName: Full=Fibronectin-binding protein A; Short=Fbps A
PTGSGVVGLSMAGSSALILAAYHPDQFVYSGSLSALLDPSQGMGPSLIGLAMGDAGGYKASDMWGPKDDP
AWARNDPMLQVGKLVANNTRIWVYCGNGKPSDLGGDNLPAKFLEGFVRTSNMKFQAAYNAAGGHNAVWN
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
M. marinum pCMV-85A
|
III. Vaccine Information |
|
|
|
|
|
|
1. M. marinum pCMV-85A |
a. Vaccine Ontology ID: |
VO_0004496 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Fish |
e. Gene Engineering of
fbpA |
- Type:
DNA vaccine construction
- Description:
Vector pcDNA 3.1 expressed Mycobacterium marinum Ag85A gene (Pasnik and Smith, 2005).
- Detailed Gene Information: Click here.
|
f. Vector: |
pcDNA 3.1 (Pasnik and Smith, 2005) |
g. Immunization Route |
Intraperitoneal injection (i.p.) |
h.
Fish Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
Fish receiving the DNA vaccine developed a protective response to a live M. marinum challenge 90 days post-inoculation, as demonstrated by increased survival of vaccinated fish over control fish and by reduced splenic bacterial counts in vaccinated fish (Pasnik and Smith, 2005).
|
|
|
|
|
|
|
|
|
IV. References |
1. Medscape - Mycobacterium marinum: Mycobacterium Marinum [http://emedicine.medscape.com/article/223363-overview]
2. Pasnik and Smith, 2005: Pasnik DJ, Smith SA. Immunogenic and protective effects of a DNA vaccine for Mycobacterium marinum in fish. Veterinary immunology and immunopathology. 2005; 103(3-4); 195-206. [PubMed: 15621306].
|